Diaphorina citri psyllid: psy7568


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFISSKSARSSHLLSVEHGL
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccc
*DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHT******************MSCRHNIRSIRCNTKRA******************************
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFISSKSARSSHLLSVEHGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0004995 [MF]tachykinin receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871, GO:0008188
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789
GO:0001601 [MF]peptide YY receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0004983, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871, GO:0008188
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0070474 [BP]positive regulation of uterine smooth muscle contractionprobableGO:0045933, GO:0044057, GO:0006937, GO:0051240, GO:0006940, GO:0065007, GO:0090257, GO:0051239, GO:0048518, GO:0008150, GO:0045987, GO:0050789, GO:0070472
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0007218 [BP]neuropeptide signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0007217 [BP]tachykinin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KS9, chain A
Confidence level:very confident
Coverage over the Query: 15-84
View the alignment between query and template
View the model in PyMOL