Psyllid ID: psy7568

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFISSKSARSSHLLSVEHGL
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEcEEEEEcccccccccccccccccccccccccccccc
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWfpnlqqlkwfPVLYFLVHWLamshpcynpviycwmngrfrvsfygvfrkvpilkhtvkkydksnlmsQAVLSDHMscrhnirsircntkraegdldelechrfissksarsshllsvehgl
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILkhtvkkydksnLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRfissksarsshllsvehgl
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFIssksarsshllsVEHGL
***YFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRA**DLDELECHRF******************
*DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVP**********************************************************************
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFISSK**************
*DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHT******************MSCRHNIRSIRCNTKRAEG****************************
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNTKRAEGDLDELECHRFISSKSARSSHLLSVEHGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
P25931464 Neuropeptide Y receptor O yes N/A 0.487 0.161 0.488 2e-17
P30975519 Tachykinin-like peptides no N/A 0.928 0.275 0.348 7e-17
P29371465 Neuromedin-K receptor OS= yes N/A 0.740 0.245 0.344 2e-15
Q03566406 Probable G-protein couple yes N/A 0.909 0.344 0.340 3e-15
P21452398 Substance-K receptor OS=H no N/A 0.850 0.329 0.333 7e-13
P79218384 Substance-K receptor OS=O yes N/A 0.753 0.302 0.356 3e-12
P05363384 Substance-K receptor OS=B yes N/A 0.753 0.302 0.348 4e-12
P16610390 Substance-K receptor OS=R yes N/A 0.759 0.3 0.338 4e-12
Q5DUB2384 Substance-K receptor OS=C yes N/A 0.694 0.278 0.358 6e-12
P30549384 Substance-K receptor OS=M yes N/A 0.759 0.304 0.338 8e-12
>sp|P25931|NPYR_DROME Neuropeptide Y receptor OS=Drosophila melanogaster GN=NepYr PE=2 SV=2 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 57/88 (64%), Gaps = 13/88 (14%)

Query: 6   MIKMMVLVVIVYTVCWLPLNIVQII------ADWFPNLQQLKWFPVLYFLVHWLAMSHPC 59
           M+KMM+ VVIV+T CWLP NI+Q++      A W P        P ++F  HWLAMSH C
Sbjct: 325 MVKMMLTVVIVFTCCWLPFNILQLLLNDEEFAHWDP-------LPYVWFAFHWLAMSHCC 377

Query: 60  YNPVIYCWMNGRFRVSFYGVFRKVPILK 87
           YNP+IYC+MN RFR  F  +  ++P L+
Sbjct: 378 YNPIIYCYMNARFRSGFVQLMHRMPGLR 405
Receptor for neuropeptide Y and peptide YY.
Drosophila melanogaster (taxid: 7227)
>sp|P30975|TLR2_DROME Tachykinin-like peptides receptor 99D OS=Drosophila melanogaster GN=Takr99D PE=2 SV=2 Back     alignment and function description
>sp|P29371|NK3R_HUMAN Neuromedin-K receptor OS=Homo sapiens GN=TACR3 PE=2 SV=1 Back     alignment and function description
>sp|Q03566|TKR1_CAEEL Probable G-protein coupled receptor tkr-1 OS=Caenorhabditis elegans GN=tkr-1 PE=3 SV=2 Back     alignment and function description
>sp|P21452|NK2R_HUMAN Substance-K receptor OS=Homo sapiens GN=TACR2 PE=2 SV=3 Back     alignment and function description
>sp|P79218|NK2R_RABIT Substance-K receptor OS=Oryctolagus cuniculus GN=TACR2 PE=2 SV=1 Back     alignment and function description
>sp|P05363|NK2R_BOVIN Substance-K receptor OS=Bos taurus GN=TACR2 PE=2 SV=1 Back     alignment and function description
>sp|P16610|NK2R_RAT Substance-K receptor OS=Rattus norvegicus GN=Tacr2 PE=2 SV=1 Back     alignment and function description
>sp|Q5DUB2|NK2R_CANFA Substance-K receptor OS=Canis familiaris GN=TACR2 PE=2 SV=1 Back     alignment and function description
>sp|P30549|NK2R_MOUSE Substance-K receptor OS=Mus musculus GN=Tacr2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
110764421 768 PREDICTED: hypothetical protein LOC41161 0.597 0.119 0.5 4e-23
328701469 416 PREDICTED: neuropeptide Y receptor-like 0.811 0.300 0.426 3e-21
195390504 589 GJ23082 [Drosophila virilis] gi|19415199 0.487 0.127 0.511 4e-20
195036544 589 GH18632 [Drosophila grimshawi] gi|193893 0.487 0.127 0.511 4e-20
350412452 432 PREDICTED: neuropeptide Y receptor-like 0.538 0.192 0.542 2e-19
383853852 434 PREDICTED: neuropeptide Y receptor-like 0.584 0.207 0.483 1e-18
345495728 571 PREDICTED: neuropeptide Y receptor-like 0.623 0.168 0.408 3e-18
194764979145 GF23269 [Drosophila ananassae] gi|190614 0.512 0.544 0.523 2e-17
195108947 463 GI24301 [Drosophila mojavensis] gi|19391 0.493 0.164 0.505 3e-17
390177533 480 GA30114 [Drosophila pseudoobscura pseudo 0.519 0.166 0.517 4e-17
>gi|110764421|ref|XP_395084.3| PREDICTED: hypothetical protein LOC411614 [Apis mellifera] Back     alignment and taxonomy information
 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%)

Query: 6   MIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIY 65
           M+KMMV VVIV+TVCWLP NI+ +I D    +    WFP ++ ++HWLAMSH CYNPVIY
Sbjct: 601 MVKMMVTVVIVFTVCWLPFNILNLIMDNNETVGSWTWFPFVWMILHWLAMSHSCYNPVIY 660

Query: 66  CWMNGRFRVSFYGVFRKVPILKHTVKKYDKSN 97
           CWMN RFR  F      +P     +++  + N
Sbjct: 661 CWMNARFRTGFIAAIGHLPGTHRILRRERRDN 692

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328701469|ref|XP_001946360.2| PREDICTED: neuropeptide Y receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195390504|ref|XP_002053908.1| GJ23082 [Drosophila virilis] gi|194151994|gb|EDW67428.1| GJ23082 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195036544|ref|XP_001989730.1| GH18632 [Drosophila grimshawi] gi|193893926|gb|EDV92792.1| GH18632 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|350412452|ref|XP_003489650.1| PREDICTED: neuropeptide Y receptor-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383853852|ref|XP_003702436.1| PREDICTED: neuropeptide Y receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345495728|ref|XP_003427564.1| PREDICTED: neuropeptide Y receptor-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|194764979|ref|XP_001964605.1| GF23269 [Drosophila ananassae] gi|190614877|gb|EDV30401.1| GF23269 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195108947|ref|XP_001999054.1| GI24301 [Drosophila mojavensis] gi|193915648|gb|EDW14515.1| GI24301 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|390177533|ref|XP_003736405.1| GA30114 [Drosophila pseudoobscura pseudoobscura] gi|388859081|gb|EIM52478.1| GA30114 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0004842464 NepYr "Neuropeptide Y receptor 0.512 0.170 0.5 2.4e-18
FB|FBgn0004622519 Takr99D "Tachykinin-like recep 0.701 0.208 0.375 8.7e-18
UNIPROTKB|F1PJN3302 TACR3 "Uncharacterized protein 0.590 0.301 0.387 6e-16
UNIPROTKB|P29371465 TACR3 "Neuromedin-K receptor" 0.740 0.245 0.344 6.1e-16
WB|WBGene00006576406 tkr-1 [Caenorhabditis elegans 0.805 0.305 0.341 6.9e-16
ZFIN|ZDB-GENE-061207-19395 tacr3l "tachykinin receptor 3- 0.590 0.230 0.419 1.1e-15
UNIPROTKB|P30098440 TACR3 "Neuromedin-K receptor" 0.590 0.206 0.408 1.4e-15
UNIPROTKB|J9NS65350 TACR3 "Uncharacterized protein 0.590 0.26 0.387 1.4e-15
UNIPROTKB|F1N2X0463 TACR3 "Uncharacterized protein 0.590 0.196 0.397 1.6e-15
MGI|MGI:892968452 Tacr3 "tachykinin receptor 3" 0.590 0.201 0.387 2e-15
FB|FBgn0004842 NepYr "Neuropeptide Y receptor-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 2.4e-18, P = 2.4e-18
 Identities = 42/84 (50%), Positives = 58/84 (69%)

Query:     6 MIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLY--FLVHWLAMSHPCYNPV 63
             M+KMM+ VVIV+T CWLP NI+Q++ +   + +   W P+ Y  F  HWLAMSH CYNP+
Sbjct:   325 MVKMMLTVVIVFTCCWLPFNILQLLLN---DEEFAHWDPLPYVWFAFHWLAMSHCCYNPI 381

Query:    64 IYCWMNGRFRVSFYGVFRKVPILK 87
             IYC+MN RFR  F  +  ++P L+
Sbjct:   382 IYCYMNARFRSGFVQLMHRMPGLR 405
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0004983 "neuropeptide Y receptor activity" evidence=IEA;NAS
GO:0004930 "G-protein coupled receptor activity" evidence=NAS
GO:0004995 "tachykinin receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0007217 "tachykinin receptor signaling pathway" evidence=ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS
GO:0007166 "cell surface receptor signaling pathway" evidence=IDA
GO:0001653 "peptide receptor activity" evidence=IPI
FB|FBgn0004622 Takr99D "Tachykinin-like receptor at 99D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJN3 TACR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P29371 TACR3 "Neuromedin-K receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00006576 tkr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061207-19 tacr3l "tachykinin receptor 3-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P30098 TACR3 "Neuromedin-K receptor" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS65 TACR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2X0 TACR3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:892968 Tacr3 "tachykinin receptor 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 6e-11
PHA02638417 PHA02638, PHA02638, CC chemokine receptor-like pro 3e-05
PHA03087335 PHA03087, PHA03087, G protein-coupled chemokine re 8e-04
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information 
 Score = 58.1 bits (141), Expect = 6e-11
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 6   MIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIY 65
             KM+++VV+V+ +CWLP +IV ++ D    L   +  P    +  WLA  + C NP+IY
Sbjct: 193 AAKMLLVVVVVFVLCWLPYHIVLLL-DSLCPLSIWRLLPTALLITLWLAYVNSCLNPIIY 251

This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251
>gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG4219|consensus423 99.85
PHA03234338 DNA packaging protein UL33; Provisional 99.83
PHA03235409 DNA packaging protein UL33; Provisional 99.8
PHA02834323 chemokine receptor-like protein; Provisional 99.75
KOG4220|consensus503 99.73
PHA02638417 CC chemokine receptor-like protein; Provisional 99.71
PHA03087335 G protein-coupled chemokine receptor-like protein; 99.62
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.18
PF10324318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 98.8
KOG2087|consensus363 98.63
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 97.91
PF10321313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 96.9
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 96.76
PF1197076 Git3_C: G protein-coupled glucose receptor regulat 96.61
PF05296303 TAS2R: Mammalian taste receptor protein (TAS2R); I 96.12
PF05462303 Dicty_CAR: Slime mold cyclic AMP receptor 95.95
PF02101405 Ocular_alb: Ocular albinism type 1 protein; InterP 94.63
PF10317292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 92.77
PF10318302 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemorecept 91.86
PF03402265 V1R: Vomeronasal organ pheromone receptor family, 91.41
KOG2575|consensus 510 90.21
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 89.03
PF10327303 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemorecept 88.94
PF03125365 Sre: C. elegans Sre G protein-coupled chemorecepto 84.8
KOG4564|consensus473 80.42
>KOG4219|consensus Back     alignment and domain information 
Probab=99.85  E-value=1.6e-21  Score=148.65  Aligned_cols=87  Identities=40%  Similarity=0.914  Sum_probs=78.8

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCccccchHHHHHHHHHHHhhhcCccchhhHhhcCHHHHHHHHHhhh
Q psy7568           2 DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFR   81 (154)
Q Consensus         2 ~~~k~~~~~~~vv~~F~~cw~Py~v~~l~~~~~~~~~~~~~~~~~~~~~~~L~~~ns~~NPiiY~~~~~~fR~~~~~~~~   81 (154)
                      +++|+.+|+++||+.|.+||+|||+..++....++....+....++....||+.+|+|+||+||++.|++||.++++.++
T Consensus       255 ak~K~vkmliiVV~~FaicWlPyh~y~il~~~~~~i~~~k~i~~vyl~~~WLaMSst~yNPiIY~~lN~Rfr~gf~~~fr  334 (423)
T KOG4219|consen  255 AKKKVVKMLIIVVVIFAICWLPYHIYFILNATNPEINRKKFIQQVYLAIYWLAMSSTCYNPIIYCFLNKRFRGGFRRAFR  334 (423)
T ss_pred             HHHHHHHHHHHHHHHHHHhccChhHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhccHhhhhhHHHHHHHHhhhhh
Confidence            47899999999999999999999999999988776667778888999999999999999999999999999999999999


Q ss_pred             ccCCccc
Q psy7568          82 KVPILKH   88 (154)
Q Consensus        82 ~~~~~~~   88 (154)
                      |++....
T Consensus       335 ~cp~v~~  341 (423)
T KOG4219|consen  335 WCPFVKG  341 (423)
T ss_pred             eeeeecc
Confidence            8864433

>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF11970 Git3_C: G protein-coupled glucose receptor regulating Gpa2 C-term; InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF02101 Ocular_alb: Ocular albinism type 1 protein; InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10318 7TM_GPCR_Srh: Serpentine type 7TM GPCR chemoreceptor Srh; InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2575|consensus Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10327 7TM_GPCR_Sri: Serpentine type 7TM GPCR chemoreceptor Sri; InterPro: IPR019429 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03125 Sre: C Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2ks9_A364 Solution Conformation Of Substance P In Water Compl 5e-10
3sn6_R514 Crystal Structure Of The Beta2 Adrenergic Receptor- 3e-05
3p0g_A501 Structure Of A Nanobody-Stabilized Active State Of 4e-05
2rh1_A500 High Resolution Crystal Structure Of Human B2-Adren 4e-05
3d4s_A490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 6e-05
3pbl_A481 Structure Of The Human Dopamine D3 Receptor In Comp 9e-05
3kj6_A366 Crystal Structure Of A Methylated Beta2 Adrenergic 2e-04
3pds_A458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 2e-04
2r4r_A365 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-04
2r4s_A342 Crystal Structure Of The Human Beta2 Adrenoceptor L 2e-04
3oax_A349 Crystal Structure Of Bovine Rhodopsin With Beta-Ion 3e-04
1jfp_A348 Structure Of Bovine Rhodopsin (Dark Adapted) Length 3e-04
4gbr_A309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 4e-04
3eml_A488 The 2.6 A Crystal Structure Of A Human A2a Adenosin 7e-04
2j4y_A349 Crystal Structure Of A Rhodopsin Stabilizing Mutant 7e-04
3c9m_A348 Structure Of A Mutant Bovine Rhodopsin In Hexagonal 7e-04
2x72_A349 Crystal Structure Of The Constitutively Active E113 8e-04
>pdb|2KS9|A Chain A, Solution Conformation Of Substance P In Water Complexed With Nk1r Length = 364 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
Query: 16  VYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVS 75
            + +CWLP +I  ++    P+L   K+   +Y  + WLAMS   YNP+IYC +N RFR+ 
Sbjct: 256 TFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLG 315
Query: 76  FYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMS 109
           F   FR  P +  +   Y+   + S   L    S
Sbjct: 316 FKHAFRCCPFI--SAGDYEGLEMKSTRYLQTQGS 347
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3PBL|A Chain A, Structure Of The Human Dopamine D3 Receptor In Complex With Eticlopride Length = 481 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|3OAX|A Chain A, Crystal Structure Of Bovine Rhodopsin With Beta-Ionone Length = 349 Back     alignment and structure
>pdb|1JFP|A Chain A, Structure Of Bovine Rhodopsin (Dark Adapted) Length = 348 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure
>pdb|3EML|A Chain A, The 2.6 A Crystal Structure Of A Human A2a Adenosine Receptor Bound To Zm241385. Length = 488 Back     alignment and structure
>pdb|2J4Y|A Chain A, Crystal Structure Of A Rhodopsin Stabilizing Mutant Expressed In Mammalian Cells Length = 349 Back     alignment and structure
>pdb|3C9M|A Chain A, Structure Of A Mutant Bovine Rhodopsin In Hexagonal Crystal Form Length = 348 Back     alignment and structure
>pdb|2X72|A Chain A, Crystal Structure Of The Constitutively Active E113q,N2c, D282c Rhodopsin Mutant With Bound Galphact Peptide Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 8e-28
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 5e-21
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 9e-16
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 3e-14
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-14
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 5e-09
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 9e-09
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 2e-07
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 2e-07
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 1e-06
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 3e-06
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 3e-06
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 6e-06
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 2e-05
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 6e-05
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
 Score =  104 bits (262), Expect = 8e-28
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 6   MIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIY 65
           ++KMM++VV  + +CWLP +I  ++    P+L   K+   +Y  + WLAMS   YNP+IY
Sbjct: 246 VVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIY 305

Query: 66  CWMNGRFRVSFYGVFRKVPILKHTVKKYDKSNLMSQAVLSDHMSCRHNIRSIRCNT 121
           C +N RFR+ F   FR  P    +   Y+   + S   L    S     +  R  T
Sbjct: 306 CCLNDRFRLGFKHAFRCCP--FISAGDYEGLEMKSTRYLQTQGSVY---KVSRLET 356
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
4grv_A510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.89
2rh1_A500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.83
3vw7_A484 Proteinase-activated receptor 1, lysozyme; high re 99.81
3eml_A488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.8
3v2y_A520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.79
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 99.79
3uon_A467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.79
4eiy_A447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.79
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 99.78
4dkl_A464 MU-type opioid receptor, lysozyme chimera; G-prote 99.77
3pbl_A481 D(3) dopamine receptor, lysozyme chimera; structur 99.77
3odu_A502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.76
3rze_A452 Histamine H1 receptor, lysozyme chimera; structura 99.76
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 99.72
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.71
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.7
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 99.68
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.68
2koe_A40 Human cannabinoid receptor 1 - helix 7/8 peptide; 99.25
2ki9_A33 Cannabinoid receptor 2; GPCR, G-protein coupled re 99.02
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.89  E-value=1.2e-24  Score=173.63  Aligned_cols=85  Identities=22%  Similarity=0.451  Sum_probs=64.2

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCcccc----chHHHHHHHHHHHhhhcCccchhhHhhcCHHHHHHHH
Q psy7568           2 DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQL----KWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFY   77 (154)
Q Consensus         2 ~~~k~~~~~~~vv~~F~~cw~Py~v~~l~~~~~~~~~~~----~~~~~~~~~~~~L~~~ns~~NPiiY~~~~~~fR~~~~   77 (154)
                      +|+|+++|+++|+++|++||+||+++.++..+.++....    ....+++.++.||+|+|||+||+||+++|++||++|+
T Consensus       403 ~erk~~k~L~iVv~~F~iCWlPf~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~Y~NS~iNPiIY~~~n~~FR~aFk  482 (510)
T 4grv_A          403 ALRHGVLVARAVVIAFVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANFRQVFL  482 (510)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCCC--
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCcccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHH
Confidence            468999999999999999999999999998876533222    3455677889999999999999999999999999999


Q ss_pred             HhhhccCCc
Q psy7568          78 GVFRKVPIL   86 (154)
Q Consensus        78 ~~~~~~~~~   86 (154)
                      ++++|.+..
T Consensus       483 ~iL~C~C~~  491 (510)
T 4grv_A          483 STLACLCPG  491 (510)
T ss_dssp             ---------
T ss_pred             HHHhhcCCC
Confidence            999865433
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>2koe_A Human cannabinoid receptor 1 - helix 7/8 peptide; GPCR, HCB1, membrane protein, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1u19a_348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 8e-11
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 56.5 bits (135), Expect = 8e-11
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 3   KYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNP 62
           +  + +M++++VI + +CWLP   V              + P+   +  + A +   YNP
Sbjct: 247 EKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSD---FGPIFMTIPAFFAKTSAVYNP 303

Query: 63  VIYCWMNGRFRVSFYGVFR 81
           VIY  MN +FR        
Sbjct: 304 VIYIMMNKQFRNCMVTTLC 322

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1u19a_348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.75
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.75  E-value=4.6e-18  Score=126.51  Aligned_cols=79  Identities=25%  Similarity=0.476  Sum_probs=67.8

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCccccchHHHHHHHHHHHhhhcCccchhhHhhcCHHHHHHHHHhhh
Q psy7568           2 DKYFMIKMMVLVVIVYTVCWLPLNIVQIIADWFPNLQQLKWFPVLYFLVHWLAMSHPCYNPVIYCWMNGRFRVSFYGVFR   81 (154)
Q Consensus         2 ~~~k~~~~~~~vv~~F~~cw~Py~v~~l~~~~~~~~~~~~~~~~~~~~~~~L~~~ns~~NPiiY~~~~~~fR~~~~~~~~   81 (154)
                      +++|+++++++++++|++||+||.++.++....+.   ......+..++.+++++||++||+||++++++||++++++++
T Consensus       246 ~~~~~~~~~~~i~~~f~~~~~P~~i~~~~~~~~~~---~~~~~~~~~~~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~l~  322 (348)
T d1u19a_         246 AEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQG---SDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLC  322 (348)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT---SCCCHHHHHHHHHHGGGGGTHHHHHHHHTCHHHHHHHHHHHT
T ss_pred             HHhhHhheEEEeehHHHHHhhHHHhhhheeeccCC---ccccHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHhC
Confidence            36899999999999999999999999888776432   223455677889999999999999999999999999999997


Q ss_pred             cc
Q psy7568          82 KV   83 (154)
Q Consensus        82 ~~   83 (154)
                      |.
T Consensus       323 c~  324 (348)
T d1u19a_         323 CG  324 (348)
T ss_dssp             SS
T ss_pred             CC
Confidence            54