Diaphorina citri psyllid: psy7569


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MKLILLMKSGQLVKSEDIRNTVGNIPMNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQAP
cEEEEEEccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHcccccccCCcc
***ILLMKSG*LVKSEDIRNTVGNIPMNWYDDLPHLGYDWSGKKIM******QL*DFLSKMENPNFWIQA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLILLMKSGQLVKSEDIRNTVGNIPMNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome biogenesis protein BOP1 homolog Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.confidentQ28XF0
Ribosome biogenesis protein BOP1 Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.confidentQ14137
Ribosome biogenesis protein ERB1 Component of the NOP7 complex, which is required for maturation of the 25S and 5.8S ribosomal RNAs and formation of the 60S ribosome.confidentP0CS34

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000463 [BP]maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0090304, GO:0034641, GO:0006807, GO:0000470, GO:0034660, GO:0071840, GO:0042273, GO:0006139, GO:0044260, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0043021 [MF]ribonucleoprotein complex bindingprobableGO:0003674, GO:0005488
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0070545 [CC]PeBoW complexprobableGO:0030686, GO:0031974, GO:0030684, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted