Diaphorina citri psyllid: psy75


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MRAIFRLVLSSTPDHHHKQNAQLRKKNVAPGMGGLEEHLRNPSSTDLFGQADAVVKHVLEGHDRGVNWACFHPTLPLIVSGKGLCLLDHGPNLFPVVLDSSDFFVPIAKLEKREGRARKQ
ccEEEEEEEECcccccEEEcccccccccccccccccccccccccccccccccEEEEEEEEEccccCEEEEEcccccEEEEcccCEECcccccCEEEEECccccEEEcHHHcHHHHHcccc
MRAIFRLVLSSTPDHHHKQNAQLR**********************LFGQADAVVKHVLEGHDRGVNWACFHPTLPLIVSGKGLCLLDHGPNLFPVVLDSSDFFVPIAK***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAIFRLVLSSTPDHHHKQNAQLRKKNVAPGMGGLEEHLRNPSSTDLFGQADAVVKHVLEGHDRGVNWACFHPTLPLIVSGKGLCLLDHGPNLFPVVLDSSDFFVPIAKLEKREGRARKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit alpha-1 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ9AUR8
Coatomer subunit alpha-3 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ0J3D9
Putative coatomer subunit alpha The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ96WV5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010883 [BP]regulation of lipid storageprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043130 [MF]ubiquitin bindingprobableGO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0001411 [CC]hyphal tipprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623
GO:0006890 [BP]retrograde vesicle-mediated transport, Golgi to ERprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0030157 [BP]pancreatic juice secretionprobableGO:0051234, GO:0046903, GO:0032501, GO:0022600, GO:0050878, GO:0044707, GO:0007589, GO:0007586, GO:0006810, GO:0044765, GO:0032941, GO:0008150, GO:0065007, GO:0065008, GO:0051179, GO:0044699, GO:0003008
GO:0030126 [CC]COPI vesicle coatprobableGO:0012506, GO:0043229, GO:0030117, GO:0005622, GO:0030135, GO:0043226, GO:0030137, GO:0005737, GO:0005575, GO:0030660, GO:0030663, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0031982, GO:0048475, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0043227, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:confident
Coverage over the Query: 5-117
View the alignment between query and template
View the model in PyMOL