Diaphorina citri psyllid: psy7609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MKHEYKLVSINSEPLRDHIKGSWVQVVDKTTKCLNRLLELGFSRRRNYILDQTNVYVSAQKRKMRSYFGFQRKAIVVVPTNEDYLARLEMHREKEGKDDVPPDNVILEMKANFKLPEVGELFEEVTYIELQHPEAEKIIDEYNKNADGTYNYPQNWNAQNWQGYGYSTTGQTGTTGQTGQSTQGASKMISAADFESGGWWFESKSRYKISLVQLFVRFLGVYLKNQ
ccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHccccccccEEEEEEEccHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccEEEccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccc
***EYKLVS****PLRDHIKGSWVQVVDKTTKCLNRLLELGFSRRRNYILDQTNVYVSAQKRKMRSYFGFQRKAIVVVPTNEDYLARL************PPDNVILEMKANFKLPEVGELFEEVTYIELQHPEAEKIIDEYNKNADGTYN********************************************SGGWWFESKSRYKISLVQLFVRFLGVYLKN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHEYKLVSINSEPLRDHIKGSWVQVVDKTTKCLNRLLELGFSRRRNYILDQTNVYVSAQKRKMRSYFGFQRKAIVVVPTNEDYLARLEMHREKEGKDDVPPDNVILEMKANFKLPEVGELFEEVTYIELQHPEAEKIIDEYNKNADGTYNYPQNWNAQNWQGYGYSTTGQTGTTGQTGQSTQGASKMISAADFESGGWWFESKSRYKISLVQLFVRFLGVYLKNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heterogeneous nuclear ribonucleoprotein U-like protein 1 Acts as a basic transcriptional regulator. Represses basic transcription driven by several virus and cellular promoters. When associated with BRD7, activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Plays also a role in mRNA processing and transport. Binds avidly to poly(G) and poly(C) RNA homopolymers in vitro.confidentQ8VDM6
Heterogeneous nuclear ribonucleoprotein U-like protein 1 Acts as a basic transcriptional regulator. Represses basic transcription driven by several virus and cellular promoters. When associated with BRD7, activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Plays also a role in mRNA processing and transport. Binds avidly to poly(G) and poly(C) RNA homopolymers in vitro.confidentQ9BUJ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZVL, chain A
Confidence level:confident
Coverage over the Query: 38-143
View the alignment between query and template
View the model in PyMOL