Diaphorina citri psyllid: psy7616

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MEQLQMVPPSIRTSPSNGQLTVRKGGTITLECKASGNPVPSIIWSKKDSSLPSGEKSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVLCKILPSGEKSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVL
ccCEEECccCEECcccccCEEEEccccEEEEEEEEcccccEEEEEEcccccccccCEECccEEEEccccccccCEEEEEEEccccccCEEEEEEEEEEEEcccccCEECccEEEEEEEcccccEEEEEEECccccccEEEEEEEEEc
**QLQMVPPSIRTS*******VRKGGTITLECKASGNPVPSIIWSKKDSSL****KSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVLCKILPSGEKSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQLQMVPPSIRTSPSNGQLTVRKGGTITLECKASGNPVPSIIWSKKDSSLPSGEKSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVLCKILPSGEKSLEGFSITLEKVDRHQAGVYQCTATNGVGDPVTVDMTLEVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0006935 [BP]chemotaxisprobableGO:0040011, GO:0042330, GO:0009605, GO:0050896, GO:0008150, GO:0042221
GO:0030246 [MF]carbohydrate bindingprobableGO:0003674, GO:0005488
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0044304 [CC]main axonprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]localizationprobableGO:0008150
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007156 [BP]homophilic cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 7-146
View the alignment between query and template
View the model in PyMOL