Diaphorina citri psyllid: psy7619

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--

MKSYDENIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYSTDRLKPRQPGKARRFTFDAVYGMQATQTEIYENSVRPMVNHMLHGYNVTIFAYGQTGT

cccccccEEEEEEcccccHHHHHcccccEEEECccccEEEEEcccccccccccccccEEEccEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEcccccc

****DENIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYST**********ARRFTFDAVYGMQATQTEIYENSVRPMVNHMLHGYNVTIFAYGQTG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKSYDENIKVVVRCRPMNVPERKAHVENVIKIDTTKKCLSIQYSTDRLKPRQPGKARRFTFDAVYGMQATQTEIYENSVRPMVNHMLHGYNVTIFAYGQTGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0005876 [CC]	spindle microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0007059 [BP]	chromosome segregation	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005871 [CC]	kinesin complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0009524 [CC]	phragmoplast	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000278 [BP]	mitotic cell cycle	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0005929 [CC]	cilium	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0051234 [BP]	establishment of localization	probable	GO:0008150, GO:0051179
GO:0051233 [CC]	spindle midzone	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0051641 [BP]	cellular localization	probable	GO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0016887 [MF]	ATPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0000778 [CC]	condensed nuclear chromosome kinetochore	probable	GO:0031974, GO:0000780, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000779, GO:0000794, GO:0000775, GO:0000776, GO:0000777, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0000793, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0008574 [MF]	plus-end-directed microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774, GO:0003777
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0042384 [BP]	cilium assembly	probable	GO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005881 [CC]	cytoplasmic microtubule	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007018 [BP]	microtubule-based movement	probable	GO:0007017, GO:0009987, GO:0006928, GO:0008150, GO:0044763, GO:0044699
GO:0007019 [BP]	microtubule depolymerization	probable	GO:0006996, GO:0032984, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0051261, GO:0031109, GO:0008150, GO:0000226, GO:0016043, GO:0022411, GO:0044763, GO:0043624, GO:0043241, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6U, chain A
Confidence level:very confident
Coverage over the Query: 16-102
View the alignment between query and template
View the model in PyMOL