Diaphorina citri psyllid: psy7632


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MKRFEESSVPIPGLGERGGAKNVCTPLHAALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPFEGKQGACRYVLGQDVVQVNDIFGLSGEKAMRHFIHRKGPVVAYVNPALMINDYTGGVISHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSWGPRWGYAGYAYVERGTNACGIERVVILAAIE
cccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccEEEccEEccccHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccEEEEEEEEccccccccEEEEEccccccccccccccccccccccccccccccccEEEEEccccccccccccEEEEEc
******SSVPIPGLGERGGAKNVCTPLHAALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPFEGKQGACRYVLGQDVVQVNDIFGLSGEKAMRHFIHRKGPVVAYVNPALMINDYTGGVISHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSWGPRWGYAGYAYVERGTNACGIERVVILAAIE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRFEESSVPIPGLGERGGAKNVCTPLHAALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPFEGKQGACRYVLGQDVVQVNDIFGLSGEKAMRHFIHRKGPVVAYVNPALMINDYTGGVISHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSWGPRWGYAGYAYVERGTNACGIERVVILAAIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0004197 [MF]cysteine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000323 [CC]lytic vacuoleprobableGO:0005737, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WBF, chain X
Confidence level:very confident
Coverage over the Query: 8-178,195-239
View the alignment between query and template
View the model in PyMOL
Template: 3BCN, chain A
Confidence level:confident
Coverage over the Query: 3-195
View the alignment between query and template
View the model in PyMOL