Psyllid ID: psy7632
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | 2.2.26 [Sep-21-2011] | |||||||
| Q3T0I2 | 335 | Pro-cathepsin H OS=Bos ta | yes | N/A | 0.720 | 0.516 | 0.343 | 7e-28 | |
| P09668 | 335 | Pro-cathepsin H OS=Homo s | yes | N/A | 0.720 | 0.516 | 0.338 | 3e-26 | |
| P56203 | 371 | Cathepsin W OS=Mus muscul | yes | N/A | 0.908 | 0.587 | 0.313 | 6e-26 | |
| O46427 | 335 | Pro-cathepsin H OS=Sus sc | no | N/A | 0.708 | 0.507 | 0.333 | 2e-25 | |
| Q6VTL7 | 324 | Viral cathepsin OS=Choris | N/A | N/A | 0.7 | 0.518 | 0.349 | 5e-25 | |
| Q8V5U0 | 367 | Viral cathepsin OS=Heliot | N/A | N/A | 0.691 | 0.452 | 0.323 | 2e-24 | |
| P41715 | 324 | Viral cathepsin OS=Choris | N/A | N/A | 0.695 | 0.515 | 0.331 | 9e-24 | |
| Q91CL9 | 324 | Viral cathepsin OS=Anther | N/A | N/A | 0.695 | 0.515 | 0.336 | 9e-24 | |
| P41721 | 323 | Viral cathepsin OS=Bombyx | N/A | N/A | 0.729 | 0.541 | 0.323 | 3e-23 | |
| P00786 | 333 | Pro-cathepsin H OS=Rattus | no | N/A | 0.720 | 0.519 | 0.328 | 3e-23 |
| >sp|Q3T0I2|CATH_BOVIN Pro-cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 124 bits (310), Expect = 7e-28, Method: Compositional matrix adjust.
Identities = 69/201 (34%), Positives = 100/201 (49%), Gaps = 28/201 (13%)
Query: 32 LEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPF 91
LE+ I G+LP L+ QQL+DC +N N+GCQGG F Y++ G+ E YP+
Sbjct: 150 LESAVAIATGKLPFLAEQQLVDC--AQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPY 207
Query: 92 EGKQGACRYVLGQDVVQVNDI--FGLSGEKAMRHFIHRKGPVVAYVNPALMINDYTGGVI 149
G+ G C+Y + + V D+ L+ E+AM + PV Y G+
Sbjct: 208 RGQDGDCKYQPSKAIAFVKDVANITLNDEEAMVEAVALHNPVSFAFEVTADFMMYRKGIY 267
Query: 150 SHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSW 209
S + +C+ P ++ H V+ VGYG+ + G+PYWIV+NSW
Sbjct: 268 S--STSCHKTPDKVNHAVLAVGYGEEK----------------------GIPYWIVKNSW 303
Query: 210 GPRWGYAGYAYVERGTNACGI 230
GP WG GY +ERG N CG+
Sbjct: 304 GPNWGMKGYFLIERGKNMCGL 324
|
Important for the overall degradation of proteins in lysosomes. Bos taurus (taxid: 9913) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 1EC: 6 |
| >sp|P09668|CATH_HUMAN Pro-cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|P56203|CATW_MOUSE Cathepsin W OS=Mus musculus GN=Ctsw PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O46427|CATH_PIG Pro-cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6VTL7|CATV_NPVCD Viral cathepsin OS=Choristoneura fumiferana defective polyhedrosis virus GN=Vcath PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P41715|CATV_NPVCF Viral cathepsin OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=Vcath PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q91CL9|CATV_NPVAP Viral cathepsin OS=Antheraea pernyi nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P41721|CATV_NPVBM Viral cathepsin OS=Bombyx mori nuclear polyhedrosis virus GN=VCATH PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P00786|CATH_RAT Pro-cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | ||||||
| 156546466 | 1036 | PREDICTED: hypothetical protein LOC10012 | 0.758 | 0.175 | 0.358 | 5e-27 | |
| 350421176 | 884 | PREDICTED: hypothetical protein LOC10074 | 0.770 | 0.209 | 0.354 | 5e-27 | |
| 77735725 | 335 | pro-cathepsin H precursor [Bos taurus] g | 0.720 | 0.516 | 0.343 | 4e-26 | |
| 383863617 | 884 | PREDICTED: uncharacterized protein LOC10 | 0.729 | 0.197 | 0.348 | 4e-26 | |
| 440910969 | 329 | Cathepsin H, partial [Bos grunniens mutu | 0.720 | 0.525 | 0.343 | 5e-26 | |
| 417399160 | 336 | Putative pro-cathepsin h [Desmodus rotun | 0.795 | 0.568 | 0.337 | 5e-26 | |
| 410960470 | 321 | PREDICTED: pro-cathepsin H [Felis catus] | 0.795 | 0.595 | 0.324 | 7e-26 | |
| 426248750 | 355 | PREDICTED: pro-cathepsin H [Ovis aries] | 0.720 | 0.487 | 0.343 | 7e-26 | |
| 338717354 | 323 | PREDICTED: pro-cathepsin H-like [Equus c | 0.795 | 0.591 | 0.328 | 2e-25 | |
| 156389068 | 276 | predicted protein [Nematostella vectensi | 0.75 | 0.652 | 0.342 | 2e-25 |
| >gi|156546466|ref|XP_001607324.1| PREDICTED: hypothetical protein LOC100123649 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 127 bits (318), Expect = 5e-27, Method: Composition-based stats.
Identities = 76/212 (35%), Positives = 115/212 (54%), Gaps = 30/212 (14%)
Query: 32 LEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPF 91
+E Q+ I+HGEL SLS Q+L+DC + + GC GG + + ++ GGL+ E DYP+
Sbjct: 850 IEGQYAIKHGELLSLSEQELVDC----DKLDSGCNGGLPDTAYRAIEELGGLELESDYPY 905
Query: 92 EGKQGACRYVLGQDVVQVNDIFGL---SGEKAMRHFIHRKGPVVAYVNPALMINDYTGGV 148
+ + C + ++ V+VN + GL S E M ++ + GP+ +N M Y GGV
Sbjct: 906 DAEDEKCHF--NKNKVKVNIVSGLNITSNETQMAQWLVKNGPMSIGINANAM-QFYMGGV 962
Query: 149 ISHDAR-ACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRN 207
SH + C+P L H V+IVGYG V ++ + + +PYWI++N
Sbjct: 963 -SHPFKFLCSP--DSLDHGVLIVGYG-----VKFYPI-----------FKKTMPYWIIKN 1003
Query: 208 SWGPRWGYAGYAYVERGTNACGIERVVILAAI 239
SWGPRWG GY V RG CG+ ++V A +
Sbjct: 1004 SWGPRWGEQGYYRVYRGDGTCGVNKMVTSAVV 1035
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350421176|ref|XP_003492760.1| PREDICTED: hypothetical protein LOC100745708 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|77735725|ref|NP_001029557.1| pro-cathepsin H precursor [Bos taurus] gi|115312126|sp|Q3T0I2.1|CATH_BOVIN RecName: Full=Pro-cathepsin H; Contains: RecName: Full=Cathepsin H mini chain; Contains: RecName: Full=Cathepsin H; Contains: RecName: Full=Cathepsin H heavy chain; Contains: RecName: Full=Cathepsin H light chain; Flags: Precursor gi|74267711|gb|AAI02387.1| Cathepsin H [Bos taurus] gi|296475480|tpg|DAA17595.1| TPA: cathepsin H precursor [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|383863617|ref|XP_003707276.1| PREDICTED: uncharacterized protein LOC100880620 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|440910969|gb|ELR60703.1| Cathepsin H, partial [Bos grunniens mutus] | Back alignment and taxonomy information |
|---|
| >gi|417399160|gb|JAA46608.1| Putative pro-cathepsin h [Desmodus rotundus] | Back alignment and taxonomy information |
|---|
| >gi|410960470|ref|XP_003986812.1| PREDICTED: pro-cathepsin H [Felis catus] | Back alignment and taxonomy information |
|---|
| >gi|426248750|ref|XP_004018122.1| PREDICTED: pro-cathepsin H [Ovis aries] | Back alignment and taxonomy information |
|---|
| >gi|338717354|ref|XP_001492337.3| PREDICTED: pro-cathepsin H-like [Equus caballus] | Back alignment and taxonomy information |
|---|
| >gi|156389068|ref|XP_001634814.1| predicted protein [Nematostella vectensis] gi|156221901|gb|EDO42751.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | ||||||
| FB|FBgn0260462 | 614 | CG12163 [Drosophila melanogast | 0.641 | 0.250 | 0.358 | 1.1e-32 | |
| MGI|MGI:1861723 | 334 | Ctsr "cathepsin R" [Mus muscul | 0.65 | 0.467 | 0.365 | 2.6e-32 | |
| DICTYBASE|DDB_G0290957 | 343 | cprA "cysteine proteinase 1" [ | 0.729 | 0.510 | 0.326 | 3.4e-32 | |
| TAIR|locus:2082687 | 367 | AT3G54940 [Arabidopsis thalian | 0.65 | 0.425 | 0.352 | 4.3e-32 | |
| TAIR|locus:2130180 | 373 | AT4G16190 [Arabidopsis thalian | 0.745 | 0.479 | 0.343 | 4e-29 | |
| DICTYBASE|DDB_G0291191 | 352 | DDB_G0291191 "cysteine proteas | 0.645 | 0.440 | 0.317 | 4e-29 | |
| UNIPROTKB|A4IFS7 | 333 | CTSL1 "CTSL1 protein" [Bos tau | 0.716 | 0.516 | 0.343 | 5.9e-29 | |
| UNIPROTKB|O60911 | 334 | CTSL2 "Cathepsin L2" [Homo sap | 0.641 | 0.461 | 0.358 | 1.2e-28 | |
| UNIPROTKB|F1RU23 | 367 | CTSW "Uncharacterized protein" | 0.837 | 0.547 | 0.336 | 3.1e-28 | |
| MGI|MGI:1338045 | 371 | Ctsw "cathepsin W" [Mus muscul | 0.904 | 0.584 | 0.324 | 1.3e-27 |
| FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 252 (93.8 bits), Expect = 1.1e-32, Sum P(2) = 1.1e-32
Identities = 61/170 (35%), Positives = 90/170 (52%)
Query: 32 LEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPF 91
+E + ++ GEL S Q+L+DC ++A C GG + + ++ GGL+ E +YP+
Sbjct: 427 IEGLYAVKTGELKEFSEQELLDCDTTDSA----CNGGLMDNAYKAIKDIGGLEYEAEYPY 482
Query: 92 EGKQGACRYVLGQDVVQVNDIFGL--SGEKAMRHFIHRKGPVVAYVNPALMINDYTGGVI 149
+ K+ C + VQV L E AM+ ++ GP+ +N M Y GGV
Sbjct: 483 KAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAM-QFYRGGV- 540
Query: 150 SHDARA-CNPHPSRLTHMVVIVGYGQS-----RAGVPYWIVRNSWGPRWG 193
SH +A C+ L H V++VGYG S +PYWIV+NSWGPRWG
Sbjct: 541 SHPWKALCSK--KNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWG 588
|
|
| MGI|MGI:1861723 Ctsr "cathepsin R" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290957 cprA "cysteine proteinase 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082687 AT3G54940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130180 AT4G16190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291191 DDB_G0291191 "cysteine protease" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4IFS7 CTSL1 "CTSL1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60911 CTSL2 "Cathepsin L2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RU23 CTSW "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1338045 Ctsw "cathepsin W" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.22 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 240 | |||
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 4e-53 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 4e-46 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-33 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 2e-22 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 6e-21 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 5e-17 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 7e-17 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 9e-17 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 2e-16 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-15 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 1e-14 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-07 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 3e-06 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 2e-04 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
Score = 170 bits (432), Expect = 4e-53
Identities = 69/205 (33%), Positives = 98/205 (47%), Gaps = 32/205 (15%)
Query: 29 AALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERD 88
LE + I+ G+L SLS QQL+DC + N GC GG+ + F Y++ GGL SE D
Sbjct: 30 VGALEGAYAIKTGKLVSLSEQQLVDC---STSGNNGCNGGNPDNAFEYVK-NGGLASESD 85
Query: 89 YPFEGKQGACRYVLGQDVVQVNDIFGLSG--EKAMRHFIHRKGPVVAYVNPALMINDYTG 146
YP+ GK G C+Y + ++ + E+A++ + GPV ++ + Y G
Sbjct: 86 YPYTGKDGTCKYNSSKVGAKITGYSNVPPGDEEALKAALANYGPVSVAIDASSSFQFYKG 145
Query: 147 GVISHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVR 206
G+ S + L H V++VGYG GV YWIV+
Sbjct: 146 GIYSG----PCCSNTNLNHAVLLVGYGTE----------------------NGVDYWIVK 179
Query: 207 NSWGPRWGYAGYAYVERGTNACGIE 231
NSWG WG GY + RG+N CGI
Sbjct: 180 NSWGTSWGEKGYIRIARGSNLCGIA 204
|
Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| KOG1544|consensus | 470 | 100.0 | ||
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.91 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.86 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.6 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 98.46 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 97.52 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 96.54 | |
| KOG4128|consensus | 457 | 96.12 | ||
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 93.76 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 93.17 | |
| PF12385 | 166 | Peptidase_C70: Papain-like cysteine protease AvrRp | 91.78 | |
| COG4990 | 195 | Uncharacterized protein conserved in bacteria [Fun | 89.4 | |
| cd02549 | 141 | Peptidase_C39A A sub-family of peptidase family C3 | 85.43 | |
| cd00044 | 315 | CysPc Calpains, domains IIa, IIb; calcium-dependen | 80.56 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-54 Score=368.74 Aligned_cols=199 Identities=39% Similarity=0.756 Sum_probs=181.7
Q ss_pred CCCCCCCCCCCCchHH-HHHHHHHHHHHHHhCCCCCCCHHHHhhcCCCCCCCCCCCCCCchhHHHHHHHHhCCcccCCCc
Q psy7632 11 IPGLGERGGAKNVCTP-LHAALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDY 89 (240)
Q Consensus 11 ~~~~~~q~~~~~~C~a-aa~~~le~~~~~~~~~~~~lS~q~l~~c~~~~~~~~~gc~GG~~~~a~~~~~~~~Gi~~e~~y 89 (240)
++|+++||.|++ ||| ++++++|.++.+++|++++||||+|+||+.. +.+|+||.+.+|++|+.+.+|+..|.+|
T Consensus 169 VTpVKnQG~CGS-CWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~----d~gC~GGl~~nA~~~~~~~gGL~~E~dY 243 (372)
T KOG1542|consen 169 VTPVKNQGMCGS-CWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSC----DNGCNGGLMDNAFKYIKKAGGLEKEKDY 243 (372)
T ss_pred ccccccCCcCcc-hhhhhhhhhhhhHHHhhcCcccccchhhhhcccCc----CCcCCCCChhHHHHHHHHhCCccccccC
Confidence 456777777666 665 8899999999999999999999999999987 8999999999999998888899999999
Q ss_pred CCCCCCC-cccccCCCceeeeceeEEeC-cHHHHHHHHHhCCCEEEEEecCcccccCCCCcccCCC-CCCCCCCCCCCcE
Q psy7632 90 PFEGKQG-ACRYVLGQDVVQVNDIFGLS-GEKAMRHFIHRKGPVVAYVNPALMINDYTGGVISHDA-RACNPHPSRLTHM 166 (240)
Q Consensus 90 PY~~~~~-~c~~~~~~~~~~i~~~~~i~-~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~gi~~~~~-~~~~~~~~~~~Ha 166 (240)
||.+... .|........+.|.++..++ ++++|.+.|.+.|||+|+|++ ..++.|.+|| ..+. ..|++.. ++|+
T Consensus 244 PY~g~~~~~C~~~~~~~~v~I~~f~~l~~nE~~ia~wLv~~GPi~vgiNa-~~mQ~YrgGV-~~P~~~~Cs~~~--~~Ha 319 (372)
T KOG1542|consen 244 PYTGKKGNQCHFDKSKIVVSIKDFSMLSNNEDQIAAWLVTFGPLSVGINA-KPMQFYRGGV-SCPSKYICSPKL--LNHA 319 (372)
T ss_pred CccccCCCccccchhhceEEEeccEecCCCHHHHHHHHHhcCCeEEEEch-HHHHHhcccc-cCCCcccCCccc--cCce
Confidence 9999887 99999999999999999999 999999999999999999996 8899999999 6642 3688877 9999
Q ss_pred EEEEEeccccCCCcceeecCCCCCCCCCCCCC-CCCEEEEEcCCCcccCcCceEEEEcCCCccccccceeEEEeC
Q psy7632 167 VVIVGYGQSRAGVPYWIVRNSWGPRWGYESRA-GVPYWIVRNSWGPRWGYAGYAYVERGTNACGIERVVILAAIE 240 (240)
Q Consensus 167 v~IVGy~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~ywivkNSWG~~WG~~Gy~~i~~~~~~cgi~~~~~~~~~~ 240 (240)
|+|||||. . . .++|||||||||+.||++||+||.||.|.|||++.++.+++.
T Consensus 320 VLlvGyG~-~---------------------g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~v~ 372 (372)
T KOG1542|consen 320 VLLVGYGS-S---------------------GYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAAVN 372 (372)
T ss_pred EEEEeecC-C---------------------CCCCceEEEECCccccccccceEEEeccccccccccchhhhhcC
Confidence 99999999 4 3 678999999999999999999999999999999999888763
|
|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
| >PF12385 Peptidase_C70: Papain-like cysteine protease AvrRpt2; InterPro: IPR022118 This is a family of cysteine proteases, found in actinobacteria, protobacteria and firmicutes | Back alignment and domain information |
|---|
| >COG4990 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd02549 Peptidase_C39A A sub-family of peptidase family C39 | Back alignment and domain information |
|---|
| >cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 240 | ||||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 2e-26 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-21 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 1e-20 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 3e-20 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-20 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 6e-20 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-19 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 2e-19 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 4e-19 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 4e-19 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 4e-19 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 5e-19 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 5e-19 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 7e-19 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 8e-19 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 1e-18 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 2e-18 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 3e-18 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 4e-18 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 5e-18 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 5e-18 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 5e-18 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 5e-18 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 6e-18 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 6e-18 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 8e-18 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 8e-18 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 8e-18 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 9e-18 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-17 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-17 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 5e-17 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 1e-16 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 1e-16 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-16 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 1e-16 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 2e-16 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 4e-16 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 4e-16 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 4e-16 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 4e-16 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 4e-16 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 4e-16 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 5e-16 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 5e-16 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 5e-16 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 5e-16 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 8e-16 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 1e-15 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 2e-15 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 2e-15 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 4e-15 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 1e-14 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 2e-14 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-14 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 5e-14 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 6e-13 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 1e-12 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 2e-12 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 3e-12 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 5e-12 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 5e-12 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 6e-12 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 1e-11 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 2e-11 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 3e-11 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 8e-11 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 9e-11 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 1e-10 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 7e-09 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 7e-09 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 3e-08 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 3e-08 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 3e-08 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 3e-08 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 7e-08 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 7e-08 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 7e-08 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 4e-07 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 4e-07 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 4e-07 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 5e-07 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 6e-07 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 8e-07 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 1e-06 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 2e-06 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 2e-06 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-06 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-06 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 5e-06 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 6e-06 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 6e-06 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 6e-06 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 1e-05 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 1e-05 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 2e-05 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 2e-05 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 2e-05 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-05 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 2e-05 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 2e-05 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 3e-05 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 3e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-04 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 2e-04 |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
|
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
Score = 160 bits (407), Expect = 2e-49
Identities = 60/200 (30%), Positives = 101/200 (50%), Gaps = 30/200 (15%)
Query: 32 LEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDYPF 91
+E Q+F+ G L SLS Q+L+DC + + C GG + + ++ GGL++E DY +
Sbjct: 34 VEGQWFLNQGTLLSLSEQELLDC----DKMDKACMGGLPSNAYSAIKNLGGLETEDDYSY 89
Query: 92 EGKQGACRYVLGQDVVQVNDIFGLSG-EKAMRHFIHRKGPVVAYVNPALMINDYTGGVIS 150
+G +C++ + V + D LS E+ + ++ ++GP+ +N A + Y G+
Sbjct: 90 QGHMQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAIN-AFGMQFYRHGISR 148
Query: 151 HDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSWG 210
C+P + H V++VGYG R+ VP+W ++NSWG
Sbjct: 149 PLRPLCSP--WLIDHAVLLVGYG----------------------QRSDVPFWAIKNSWG 184
Query: 211 PRWGYAGYAYVERGTNACGI 230
WG GY Y+ RG+ ACG+
Sbjct: 185 TDWGEKGYYYLHRGSGACGV 204
|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 100.0 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 100.0 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.97 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 97.7 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 97.4 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 96.95 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 93.31 |
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.1e-56 Score=373.05 Aligned_cols=202 Identities=32% Similarity=0.689 Sum_probs=183.1
Q ss_pred CCCCCCCCCCCCchHH-HHHHHHHHHHHHHhCCCCCCCHHHHhhcCCCCCCCCCCCCCCchhHHHHHHHHhCCcccCCCc
Q psy7632 11 IPGLGERGGAKNVCTP-LHAALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERDY 89 (240)
Q Consensus 11 ~~~~~~q~~~~~~C~a-aa~~~le~~~~~~~~~~~~lS~q~l~~c~~~~~~~~~gc~GG~~~~a~~~~~~~~Gi~~e~~y 89 (240)
++|+++|+.|++ ||| +++++||+++++++++.++||||+|++|+... .+.+|+||++..|++|+.++.|+++|++|
T Consensus 14 vtpVkdQg~cGs-CWAfa~~~~le~~~~i~~~~~~~lS~q~l~dc~~~~--~~~gC~GG~~~~a~~~~~~~~Gi~~e~~y 90 (220)
T 8pch_A 14 VSPVKNQGSCGS-CWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNF--NNHGCQGGLPSQAFEYIRYNKGIMGEDTY 90 (220)
T ss_dssp SCCCCBCTTSCC-HHHHHHHHHHHHHHHHHHCCCCCBCHHHHHHHGGGG--TCCGGGCCCHHHHHHHHHHHTCEEBTTTS
T ss_pred CCcccccCCCch-HHHHHHHHHHHHHHHHHcCCCCCCCHHHHhhCcCcc--CCCCCCCCCHHHHHHHHHHcCCcCccccc
Confidence 788999887665 665 88999999999999999999999999998642 36899999999999999988899999999
Q ss_pred CCCCCCCcccccCCCceeeeceeEEeC--cHHHHHHHHHhCCCEEEEEecCcccccCCCCcccCCCCCCCCCCCCCCcEE
Q psy7632 90 PFEGKQGACRYVLGQDVVQVNDIFGLS--GEKAMRHFIHRKGPVVAYVNPALMINDYTGGVISHDARACNPHPSRLTHMV 167 (240)
Q Consensus 90 PY~~~~~~c~~~~~~~~~~i~~~~~i~--~~~~ik~~l~~~gPV~v~~~~~~~f~~y~~gi~~~~~~~~~~~~~~~~Hav 167 (240)
||.+....|+..+....+++++|..++ +++.||++|+++|||+++|.++++|+.|++|| |.. +.|......++|||
T Consensus 91 PY~~~~~~C~~~~~~~~~~i~~~~~v~~~~~~~ik~~l~~~gPV~~~~~~~~~f~~Y~~Gi-y~~-~~~~~~~~~~~HaV 168 (220)
T 8pch_A 91 PYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGI-YSS-TSCHKTPDKVNHAV 168 (220)
T ss_dssp CCCSSCCCCCCCGGGEEECEEEEEECCTTCHHHHHHHHHHTCCEEEEECCCHHHHTCCSSE-ECC-SSCCCSTTTCCEEE
T ss_pred CccCCCCCCCCCCCcceEEeCCEEEeCCCCHHHHHHHHHhcCCEEEEEEeccchhhcCCCc-ccC-CcCCCCCCcCCcEE
Confidence 999999999987777788999999997 89999999999999999999999999999999 887 56665433489999
Q ss_pred EEEEeccccCCCcceeecCCCCCCCCCCCCCCCCEEEEEcCCCcccCcCceEEEEcCCCccccccceeEEEe
Q psy7632 168 VIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNSWGPRWGYAGYAYVERGTNACGIERVVILAAI 239 (240)
Q Consensus 168 ~IVGy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ywivkNSWG~~WG~~Gy~~i~~~~~~cgi~~~~~~~~~ 239 (240)
+|||||+ + ++.+|||||||||+.||++|||||+|+.|.|||++++.||+.
T Consensus 169 ~iVGyg~-~---------------------~g~~yWivkNSWG~~WGe~Gy~~i~r~~n~cgi~~~~~~~~p 218 (220)
T 8pch_A 169 LAVGYGE-E---------------------NGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIP 218 (220)
T ss_dssp EEEEEEE-E---------------------TTEEEEEEECSBCTTSTBTTEEEEECSSCGGGTTTSCEEEEE
T ss_pred EEEEEEc-c---------------------CCeeEEEEECCCCcCcccCCEEEEEcCCCccccCCCceeEee
Confidence 9999998 6 678899999999999999999999999999999999999985
|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 240 | ||||
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-25 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-24 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 2e-23 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-23 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-22 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 2e-22 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 2e-21 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 2e-21 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-21 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 4e-21 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 1e-20 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 4e-19 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 9e-19 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 1e-18 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 1e-18 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-18 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 2e-18 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-17 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 6e-17 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 4e-14 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 2e-05 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 6e-04 |
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Falcipain 2 species: Plasmodium falciparum [TaxId: 5833]
Score = 98.1 bits (243), Expect = 1e-25
Identities = 47/207 (22%), Positives = 81/207 (39%), Gaps = 26/207 (12%)
Query: 29 AALLEAQFFIRHGELPSLSVQQLIDCHNPENAANYGCQGGHAMSTFYYLQIAGGLQSERD 88
+E+Q+ IR +L +LS Q+L+DC NYGC GG + F + GG+ + D
Sbjct: 48 IGSVESQYAIRKNKLITLSEQELVDCSFK----NYGCNGGLINNAFEDMIELGGICPDGD 103
Query: 89 YPFEGKQGACRYVLGQDVVQVNDIFGLSGEKAMRHFIHRKGPVVAYVNPALMINDYTGGV 148
YP+ + + + ++ + GP+ V + Y G+
Sbjct: 104 YPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGI 163
Query: 149 ISHDARACNPHPSRLTHMVVIVGYGQSRAGVPYWIVRNSWGPRWGYESRAGVPYWIVRNS 208
+L H V++VG+G P + Y+I++NS
Sbjct: 164 FDG------ECGDQLNHAVMLVGFGMKEIVNPLT------------KKGEKHYYYIIKNS 205
Query: 209 WGPRWGYAGYAYVERGTNA----CGIE 231
WG +WG G+ +E + CG+
Sbjct: 206 WGQQWGERGFINIETDESGLMRKCGLG 232
|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.66 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 99.55 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 96.33 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 95.99 |
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|