Diaphorina citri psyllid: psy7639

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120------2130------2140------2150------2160------2170------2180------2190------2200------2210------2220------2230------2240------2250------2260------2270------2280------2290------2300------2310------2320------2330------2340------2350------2360------2370------2380------2390------2400------2410------2420------2430------2440------2450------2460------2470------2480------2490------2500------2510------2520------2530------2540------2550------2560------257

MKESYIAEGPCAISPAQRRVMRDPGRVVERAALELRVKSLTNPLSYFTGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKERISARNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMHGGAGGASAGDMPRGGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKERISARNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMHGGAGGASAGDMPRGGPTNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKERISARNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKERISARNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMHGGAGGASAGDMPRGGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKERISARNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMHGGASAGDMPRGGPTVEEVD

cccccccccccccccccccccccccEEEccccccccEEEEcccccccccHHHHHHHHccccccccccccccccccccHHHHHHcccccCEEEccccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccEEEEccHHHHHHHHHcccccccccEEEEEEEccccccEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHcccccccccccccHHHHcccccccCEEEccccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccEEEEccHHHHHHHHHcccccccccEEEEEEEccccccEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccCEEEccccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccEEEEccHHHHHHHHHcccccccccEEEEEEEccccccEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccCEEEccccccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccEEEEccHHHHHHHHHcccccccccEEEEEEEccccccEEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccCEEEEEEEccccccccEEECcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc

***SYIA*GPCAISPAQRRVMRDPGRVVERAALELRVKSLTNPLSYFTGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKD*********SARNNLEAYVFNVKQAL*************RCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMH************************NPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDEDERQKE**SARNNLEAYVFNVKQAL**************CREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLM*********************NFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAER**************RNNLEAYVFNVKQA*********ESEKSRCREECDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKD*********SARNNLEAYVFNVKQAL*************RCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMPLMSKMHG*******************QVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRALRRLRTAAERAKRTLSSSTEASIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSKEEIDRMINDAERYKDE********SARNNLEAYVFNVKQAL*************RCREECDATLKWLDNNTLADKEEYQDKLQQLQKSCMP*************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKESYIAEGPCAISPAQRRVMRDPGRVVERAALELRVKSLTNPLSYFTGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRAxxxxxxxxxxxxxxxxxxxxxSIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLxxxxxxxxxxxxxxxxxxxxxCMPLMSKMHGGAGGASAGDMPRGGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRAxxxxxxxxxxxxxxxxxxxxxSIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLxxxxxxxxxxxxxxxxxxxxxCMPLMSKMHGGAGGASAGDMPRGGPTNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMSKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNLEAYVFNVKQALDNAGxxxxxxxxxxxxxxxxxxxxxVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRAxxxxxxxxxxxxxxxxxxxxxSIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLxxxxxxxxxxxxxxxxxxxxxCMPLMSKMHGGAGGASAGDMPRGGDAAKNQVAMNPKNTVFDAKRLIGRKFDDPKIQQDMKHWPFTVVNDCSKPKIQVEFKGERKTFAPEEISSMVLTKMKETAEAYLGHSVRDAVITVPAYFNDAQRQATKDAGAIAGLNVMRIVNEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILSIDEGALFEVRSTAGDTHLGGEDFDNRLVSHLAEEFKRKYKKDMSVNPRAxxxxxxxxxxxxxxxxxxxxxSIEIDALYDGIDFYTKISRARFEELCSDLFRSTLQPVEKALQDAKLDKSAIHDVVLVGGSTRIPKVQSLLQNFFCGKSLNLSINPDEAVAYGAAVQAAILSGDQSSAIQDVLLVDVTPLSLGIETAGGVMTKLIERNTRIPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVTAKDTSSGKSQNITIKNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNNLEAYVFNVKQALDNAGNKLTESEKSRCREECDATLKWLxxxxxxxxxxxxxxxxxxxxxCMPLMSKMHGGASAGDMPRGGPTVEEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heat shock 70 kDa protein 1A/1B	In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell.	confident	P08107
Heat shock 70 kDa protein 1	In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.	confident	Q7YQC6
Heat shock 70 kDa protein 1A	In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.	confident	Q61696

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005875 [CC]	microtubule associated complex	confident	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008180 [CC]	signalosome	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0030445 [CC]	yeast-form cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0030446 [CC]	hyphal cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016887 [MF]	ATPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044416 [BP]	induction by symbiont of host defense response	probable	GO:0050896, GO:0048584, GO:0048583, GO:0031349, GO:0052200, GO:0050789, GO:0031347, GO:0075136, GO:0052031, GO:0052509, GO:0044419, GO:0051817, GO:0048518, GO:0065007, GO:0065008, GO:0052510, GO:0052251, GO:0008150, GO:0052255, GO:0051701, GO:0051707, GO:0044003, GO:0051704, GO:0052173, GO:0009607, GO:0080134, GO:0044403, GO:0035821
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035080 [BP]	heat shock-mediated polytene chromosome puffing	probable	GO:0006996, GO:0009628, GO:0051716, GO:0051276, GO:0034605, GO:0009987, GO:0035079, GO:0008150, GO:0006950, GO:0044763, GO:0016043, GO:0033554, GO:0009266, GO:0071840, GO:0009408, GO:0050896, GO:0044699
GO:0005844 [CC]	polysome	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0051082 [MF]	unfolded protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051168 [BP]	nuclear export	probable	GO:0051169, GO:0051234, GO:0046907, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030176 [CC]	integral to endoplasmic reticulum membrane	probable	GO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000974 [CC]	Prp19 complex	probable	GO:0043234, GO:0005575, GO:0032991
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0009410 [BP]	response to xenobiotic stimulus	probable	GO:0042221, GO:0050896, GO:0008150
GO:0061077 [BP]	chaperone-mediated protein folding	probable	GO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0042026 [BP]	protein refolding	probable	GO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0047485 [MF]	protein N-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0031427 [BP]	response to methotrexate	probable	GO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:1901698, GO:0014070
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0070062 [CC]	extracellular vesicular exosome	probable	GO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0009636 [BP]	response to toxic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006412 [BP]	translation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0002199 [CC]	zona pellucida receptor complex	probable	GO:0043234, GO:0005575, GO:0032991
GO:0016592 [CC]	mediator complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0033033 [BP]	negative regulation of myeloid cell apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0043066, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523, GO:0033032
GO:0016192 [BP]	vesicle-mediated transport	probable	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0034663 [CC]	endoplasmic reticulum chaperone complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051787 [MF]	misfolded protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0016363 [CC]	nuclear matrix	probable	GO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005726 [CC]	perichromatin fibrils	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0002020 [MF]	protease binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0031625 [MF]	ubiquitin protein ligase binding	probable	GO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0051726 [BP]	regulation of cell cycle	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016235 [CC]	aggresome	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0000060 [BP]	protein import into nucleus, translocation	probable	GO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0006810, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0022411 [BP]	cellular component disassembly	probable	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0022008 [BP]	neurogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0090084 [BP]	negative regulation of inclusion body assembly	probable	GO:0090083, GO:0009987, GO:0051129, GO:0051128, GO:0008150, GO:0044087, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0036128 [CC]	CatSper complex	probable	GO:0043234, GO:0032991, GO:0071944, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034704, GO:0005891, GO:0034702, GO:0034703, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0043022 [MF]	ribosome binding	probable	GO:0043021, GO:0003674, GO:0005488
GO:0001916 [BP]	positive regulation of T cell mediated cytotoxicity	probable	GO:0048584, GO:0048583, GO:0002819, GO:0002706, GO:0002705, GO:0002703, GO:0031341, GO:0031343, GO:0050789, GO:0002709, GO:0002708, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0002824, GO:0002822, GO:0002821, GO:0002711, GO:0008150, GO:0050776, GO:0050778, GO:0001912, GO:0002697, GO:0001910, GO:0001914, GO:0002699
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0034099 [CC]	luminal surveillance complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005783, GO:0070013, GO:0043233, GO:0044464, GO:0043229, GO:0005788, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0031974, GO:0005575, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006952 [BP]	defense response	probable	GO:0006950, GO:0008150, GO:0050896
GO:0032075 [BP]	positive regulation of nuclease activity	probable	GO:0032069, GO:0051336, GO:0080090, GO:0051345, GO:0065009, GO:0060255, GO:0050790, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0044093, GO:0008150, GO:0019222, GO:0050789, GO:0043085
GO:0001673 [CC]	male germ cell nucleus	probable	GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0010608 [BP]	posttranscriptional regulation of gene expression	probable	GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0000329 [CC]	fungal-type vacuole membrane	probable	GO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0030433 [BP]	ER-associated protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0042277 [MF]	peptide binding	probable	GO:0033218, GO:0003674, GO:0005488
GO:0006983 [BP]	ER overload response	probable	GO:0006984, GO:0051716, GO:0009607, GO:0044700, GO:0050896, GO:0009987, GO:0008150, GO:0050794, GO:0023052, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0071216, GO:0050789, GO:0044699, GO:0034976
GO:0051084 [BP]	'de novo' posttranslational protein folding	probable	GO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051083 [BP]	'de novo' cotranslational protein folding	probable	GO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0007339 [BP]	binding of sperm to zona pellucida	probable	GO:0008037, GO:0048610, GO:0009988, GO:0000003, GO:0044707, GO:0032501, GO:0009987, GO:0009566, GO:0035036, GO:0019953, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0008150, GO:0044699
GO:0044183 [MF]	protein binding involved in protein folding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0030968 [BP]	endoplasmic reticulum unfolded protein response	probable	GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0006402 [BP]	mRNA catabolic process	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0007140 [BP]	male meiosis	probable	GO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0000795 [CC]	synaptonemal complex	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0009615 [BP]	response to virus	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0009617 [BP]	response to bacterium	probable	GO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0005793 [CC]	endoplasmic reticulum-Golgi intermediate compartment	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031965 [CC]	nuclear membrane	probable	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051861 [MF]	glycolipid binding	probable	GO:0003674, GO:0008289, GO:0005488
GO:0006616 [BP]	SRP-dependent cotranslational protein targeting to membrane, translocation	probable	GO:0008104, GO:0006613, GO:0006612, GO:0006614, GO:0051641, GO:0044699, GO:0070972, GO:0071806, GO:0070727, GO:0006886, GO:0051179, GO:0065002, GO:0071702, GO:0033036, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0055085, GO:0016482, GO:0046907, GO:0045047, GO:0015031, GO:0008150, GO:0009987
GO:0045648 [BP]	positive regulation of erythrocyte differentiation	probable	GO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0071353 [BP]	cellular response to interleukin-4	probable	GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0030018 [CC]	Z disc	probable	GO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0042149 [BP]	cellular response to glucose starvation	probable	GO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0051087 [MF]	chaperone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0097223 [CC]	sperm part	probable	GO:0005575, GO:0044464, GO:0005623
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045860 [BP]	positive regulation of protein kinase activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0030496 [CC]	midbody	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044085 [BP]	cellular component biogenesis	probable	GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I33, chain A
Confidence level:very confident
Coverage over the Query: 1380-1748
View the alignment between query and template
View the model in PyMOL

Template: 3I33, chain A
Confidence level:very confident
Coverage over the Query: 1986-2321
View the alignment between query and template
View the model in PyMOL

Template: 3DOB, chain A
Confidence level:very confident
Coverage over the Query: 1241-1388
View the alignment between query and template
View the model in PyMOL

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 1381-1920
View the alignment between query and template
View the model in PyMOL

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 1986-2493
View the alignment between query and template
View the model in PyMOL

Template: 1U00, chain A
Confidence level:very confident
Coverage over the Query: 2334-2551
View the alignment between query and template
View the model in PyMOL

Template: 1U00, chain A
Confidence level:very confident
Coverage over the Query: 1761-1977
View the alignment between query and template
View the model in PyMOL

Template: 3LOF, chain A
Confidence level:very confident
Coverage over the Query: 2471-2549
View the alignment between query and template
View the model in PyMOL

Template: 3LOF, chain A
Confidence level:very confident
Coverage over the Query: 1102-1182
View the alignment between query and template
View the model in PyMOL

Template: 1JCE, chain A
Confidence level:very confident
Coverage over the Query: 2-66,87-379
View the alignment between query and template
View the model in PyMOL

Template: 3JS6, chain A
Confidence level:very confident
Coverage over the Query: 710-813,827-843,868-953
View the alignment between query and template
View the model in PyMOL

Template: 3C7N, chain B
Confidence level:very confident
Coverage over the Query: 622-1118
View the alignment between query and template
View the model in PyMOL

Template: 2QW9, chain A
Confidence level:very confident
Coverage over the Query: 49-382
View the alignment between query and template
View the model in PyMOL

Template: 3D2E, chain A
Confidence level:confident
Coverage over the Query: 43-595,613-628
View the alignment between query and template
View the model in PyMOL