Diaphorina citri psyllid: psy7641


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MLGVYQLGIEDEQGFPSSQVNLRLHSILRQSMGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ
cccEEEEcccccccccCEEEEccHHHHHHccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHcc
MLGVYQ*GIEDEQGFPSSQVNLRLHSILRQSMGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGVYQLGIEDEQGFPSSQVNLRLHSILRQSMGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0004473 [MF]malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activityprobableGO:0016614, GO:0016615, GO:0016616, GO:0004470, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GQ2, chain A
Confidence level:very confident
Coverage over the Query: 22-85
View the alignment between query and template
View the model in PyMOL