Diaphorina citri psyllid: psy7662

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220

MEDDQFKSNKNVCVFSFQFEEEEQDTPVNLPSGRKRMFSKELRCMMYGFGDDRNPYTESVDILEDAVIDFLVDMTQKAMEMGRTGPTFLSLLKFKSNKNVCVFSFQFEEEEQDTPVNLPSGRKRMFSKELRCMMYGFGDDRNPYTESVDILEDAVIDFLVDMTQKAMEMGRTGRVQVEDIVFLVRKDNRKYARVKDLLTMNEELKKARKAFDEVKFVTNA

cccccccccccccccccccccHHcccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccHccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

***********VCVFSFQF******************FSKELRCMMYGFGDDRNPYTESVDILEDAVIDFLVDMTQKAMEMGRTGPTFLSLLKFKSNKNVCVFSFQF******************FSKELRCMMYGFGDDRNPYTESVDILEDAVIDFLVDMTQKAMEMGRTGRVQVEDIVFLVRKDNRKYARVKDLLTMNEELKKARKAFD****V***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription initiation factor TFIID subunit 13	TFIID beta-specific TAFII.	confident	P61216
Transcription initiation factor TFIID subunit 13	TFIID beta-specific TAFII.	confident	Q5R9W6
Transcription initiation factor TFIID subunit 13	TFIID beta-specific TAFII.	confident	Q148M7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005669 [CC]	transcription factor TFIID complex	probable	GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0006368 [BP]	transcription elongation from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0008022 [MF]	protein C-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0016032 [BP]	viral reproduction	probable	GO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BH9, chain A
Confidence level:very confident
Coverage over the Query: 125-169
View the alignment between query and template
View the model in PyMOL

Template: 1BH9, chain A
Confidence level:very confident
Coverage over the Query: 37-81
View the alignment between query and template
View the model in PyMOL

Template: 1F1E, chain A
Confidence level:probable
Coverage over the Query: 50-187
View the alignment between query and template
View the model in PyMOL