Diaphorina citri psyllid: psy7665


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSLPKLGGSEVSTFITAEISSNNAGEITQGYALGVMLGAYKQDFDALIGIHPTCAEAISLSWIKGYNIEPEVIKLHTPYLVLAKARFLLPTLECQEVYHDGRFYDYLDNNFQTYDYDLCVIGGGSGGISAAKEAASMNKKVALFDFVTPSQHGTVWGLGGTCVNVGCIPKKLFHRASLLNEEATTSDNFGFHMKKSFTWKTLVDNVQKYIRNLNNNYEKELEKNKIDYFNAKAVFVDKHRVKFAGEERTVSAQNFIIAVGGRPTYPDIPGARLLRTLSLLSGVDPPTLIFLEHISA
ccccccccccccEEEEEEECccccHHHHHHHHHHHHccccHHHHHHHHcccccccccEEEEEECcccccccccccccccEEEEcccccccccHHHHHHcccccccccccccccccccEEEEccccHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEccccHHHHHHHHHccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccEEEEccCEEEEEEcEEEEccccccccccccccEEEEccccccccccccEEEEccccc
********SEVSTFITAEISSNNAGEITQGYALGVMLGAYKQDFDALIGIHPTCAEAISLSWIKGYNIEPEVIKLHTPYLVLAKARFLLPTLECQEVYHDGRFYDYLDNNFQTYDYDLCVIGGGSGGISAAKEAASMNKKVALFDFVTPSQHGTVWGLGGTCVNVGCIPKKLFHRASLLNEEATTSDNFGFHMKKSFTWKTLVDNVQKYIRNLNNNYEKELEKNKIDYFNAKAVFVDKHRVKFAGEERTVSAQNFIIAVGGRPTYPDIPGARLLRTLSLLSGVDPPTLIFLEHIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPKLGGSEVSTFITAEISSNNAGEITQGYALGVMLGAYKQDFDALIGIHPTCAEAISLSWIKGYNIEPEVIKLHTPYLVLAKARFLLPTLECQEVYHDGRFYDYLDNNFQTYDYDLCVIGGGSGGISAAKEAASMNKKVALFDFVTPSQHGTVWGLGGTCVNVGCIPKKLFHRASLLNEEATTSDNFGFHMKKSFTWKTLxxxxxxxxxxxxxxxxxxxxxNKIDYFNAKAVFVDKHRVKFAGEERTVSAQNFIIAVGGRPTYPDIPGARLLRTLSLLSGVDPPTLIFLEHISA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin reductase 2, mitochondrial Maintains thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox-regulated cell signaling.confidentQ9N2I8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004791 [MF]thioredoxin-disulfide reductase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016651, GO:0016667, GO:0016668, GO:0016491
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DGH, chain A
Confidence level:very confident
Coverage over the Query: 114-294
View the alignment between query and template
View the model in PyMOL
Template: 2X8G, chain A
Confidence level:very confident
Coverage over the Query: 87-294
View the alignment between query and template
View the model in PyMOL
Template: 3O0H, chain A
Confidence level:very confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL
Template: 3K30, chain A
Confidence level:confident
Coverage over the Query: 50-161,197-199,211-265
View the alignment between query and template
View the model in PyMOL