Diaphorina citri psyllid: psy7671


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
ccEEEEEcccccEEEEEEEccccccccccccEECccccccccccHHHHHcccccccEEEEEECccccEEEEEcccccEEEEECccccccCEEEEEEcHHHHHHHHHHcEEEEccc
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005643 [CC]nuclear poreprobableGO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F3F, chain A
Confidence level:probable
Coverage over the Query: 53-97
View the alignment between query and template
View the model in PyMOL
Template: 4FHN, chain B
Confidence level:probable
Coverage over the Query: 4-31,50-86
View the alignment between query and template
View the model in PyMOL