Psyllid ID: psy7671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
ccEEEEEcccccEEEEEEEccccccccccccEEEccccccccccHHHHHcccccccEEEEEEEccccEEEEEcccccEEEEEEccccccEEEEEEEcHHHHHHHHHHcEEEEccc
cEEEEEEcccccEEEEEEEcccccHHHccccEcccccHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEccccEEEEEEcccccccccEEEEEcHHHHHHHHHHHHHHHccc
MIVVFmggtdgnlyeikyqrdaswfsascskvcltsssltyILPTFINALITQEDSLAQICidnsrnvlytrselglisvydlyergqgfrSLVSLSEEMIVQQALKFHIVYAKL
mivvfmggtdgnlYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
*IVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYA**
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALKFHIVYAKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
O75694 1391 Nuclear pore complex prot yes N/A 0.886 0.073 0.470 5e-24
Q99P88 1391 Nuclear pore complex prot yes N/A 0.886 0.073 0.470 1e-23
P37199 1390 Nuclear pore complex prot yes N/A 0.860 0.071 0.474 2e-23
Q9URX8 1315 Probable nucleoporin C890 yes N/A 0.730 0.063 0.388 6e-12
P38181 1502 Nucleoporin NUP170 OS=Sac yes N/A 0.730 0.055 0.317 5e-08
P40064 1391 Nucleoporin NUP157 OS=Sac no N/A 0.739 0.061 0.306 4e-07
>sp|O75694|NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 70/102 (68%)

Query: 4   VFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICID 63
           +F+ G DG LYE+ YQ +A WFS  C K+  + SSL++++P+ +    +++D + QI ID
Sbjct: 226 IFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAID 285

Query: 64  NSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQA 105
           NSRN+LYTRSE G+I VYDL + GQG   + S+S+  IV  A
Sbjct: 286 NSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAA 327
Essential component of nuclear pore complex. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport.
Homo sapiens (taxid: 9606)
>sp|Q99P88|NU155_MOUSE Nuclear pore complex protein Nup155 OS=Mus musculus GN=Nup155 PE=2 SV=1 Back     alignment and function description
>sp|P37199|NU155_RAT Nuclear pore complex protein Nup155 OS=Rattus norvegicus GN=Nup155 PE=1 SV=1 Back     alignment and function description
>sp|Q9URX8|NG06_SCHPO Probable nucleoporin C890.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC890.06 PE=3 SV=3 Back     alignment and function description
>sp|P38181|NU170_YEAST Nucleoporin NUP170 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP170 PE=1 SV=1 Back     alignment and function description
>sp|P40064|NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP157 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
387017426 1390 Nucleoporin 155kDa [Crotalus adamanteus] 0.904 0.074 0.471 2e-22
149732782 1391 PREDICTED: nuclear pore complex protein 0.886 0.073 0.470 2e-22
345313422 1305 PREDICTED: nuclear pore complex protein 0.886 0.078 0.470 2e-22
403267863 1303 PREDICTED: nuclear pore complex protein 0.886 0.078 0.470 2e-22
426384911 1265 PREDICTED: nuclear pore complex protein 0.886 0.080 0.470 2e-22
291395257 1391 PREDICTED: nucleoporin 155kDa [Oryctolag 0.886 0.073 0.470 2e-22
441615115 1563 PREDICTED: nuclear pore complex protein 0.886 0.065 0.470 2e-22
297675137 1393 PREDICTED: nuclear pore complex protein 0.886 0.073 0.470 2e-22
194386160 1353 unnamed protein product [Homo sapiens] 0.886 0.075 0.470 2e-22
390460090 1252 PREDICTED: LOW QUALITY PROTEIN: nuclear 0.886 0.081 0.470 2e-22
>gi|387017426|gb|AFJ50831.1| Nucleoporin 155kDa [Crotalus adamanteus] Back     alignment and taxonomy information
 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%)

Query: 4   VFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICID 63
           +FM G DG LYE+ YQ +A WFS  C K+  + S+L++++P+ +    +++D + QI ID
Sbjct: 220 IFMAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSTLSFLVPSLLQFTFSEDDPIVQIAID 279

Query: 64  NSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQALK 107
           NSRN+LYTRSE G+I VYDL   GQG   + S+S+  IV  A K
Sbjct: 280 NSRNILYTRSEKGVIQVYDLGPDGQGMVRVASVSQNAIVSAAGK 323

Source: Crotalus adamanteus

Species: Crotalus adamanteus

Genus: Crotalus

Family: Viperidae

Order: Squamata

Class:

Phylum: Chordata

Superkingdom: Eukaryota
>gi|149732782|ref|XP_001499533.1| PREDICTED: nuclear pore complex protein Nup155 isoform 1 [Equus caballus] Back     alignment and taxonomy information
>gi|345313422|ref|XP_001509326.2| PREDICTED: nuclear pore complex protein Nup155, partial [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|403267863|ref|XP_003926018.1| PREDICTED: nuclear pore complex protein Nup155 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|426384911|ref|XP_004058986.1| PREDICTED: nuclear pore complex protein Nup155 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|291395257|ref|XP_002714026.1| PREDICTED: nucleoporin 155kDa [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|441615115|ref|XP_003274405.2| PREDICTED: nuclear pore complex protein Nup155 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|297675137|ref|XP_002815550.1| PREDICTED: nuclear pore complex protein Nup155 [Pongo abelii] Back     alignment and taxonomy information
>gi|194386160|dbj|BAG59644.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|390460090|ref|XP_002745098.2| PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein Nup155, partial [Callithrix jacchus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
UNIPROTKB|E2QVP9 772 NUP155 "Uncharacterized protei 0.886 0.132 0.460 1.6e-21
UNIPROTKB|E9PF10 1327 NUP155 "Nuclear pore complex p 0.886 0.076 0.470 2.3e-21
UNIPROTKB|O75694 1391 NUP155 "Nuclear pore complex p 0.886 0.073 0.470 2.4e-21
UNIPROTKB|F1NNT9 1348 NUP155 "Uncharacterized protei 0.886 0.075 0.460 3e-21
UNIPROTKB|F1NPS0 1394 NUP155 "Uncharacterized protei 0.886 0.073 0.460 3.1e-21
UNIPROTKB|F1SN95 1460 NUP155 "Uncharacterized protei 0.886 0.069 0.460 3.3e-21
UNIPROTKB|F6XTD9 1390 NUP155 "Uncharacterized protei 0.886 0.073 0.460 3.9e-21
MGI|MGI:2181182 1391 Nup155 "nucleoporin 155" [Mus 0.886 0.073 0.470 8.2e-21
ZFIN|ZDB-GENE-040426-711 1391 nup155 "nucleoporin 155" [Dani 0.886 0.073 0.450 8.2e-21
UNIPROTKB|F1MNT1 1391 NUP155 "Uncharacterized protei 0.886 0.073 0.450 1.1e-20
UNIPROTKB|E2QVP9 NUP155 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 262 (97.3 bits), Expect = 1.6e-21, P = 1.6e-21
 Identities = 47/102 (46%), Positives = 70/102 (68%)

Query:     4 VFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICID 63
             +F+ G DG LYE+ YQ +A WFS  C K+  + S+L++++P+ +    +++D + QI ID
Sbjct:   230 IFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSALSFLVPSLLQFTFSEDDPIVQIAID 289

Query:    64 NSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSEEMIVQQA 105
             NSRN+LYTRSE G+I VYDL + GQG   + S+S+  IV  A
Sbjct:   290 NSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNSIVSAA 331
GO:0017056 "structural constituent of nuclear pore" evidence=IEA
GO:0006913 "nucleocytoplasmic transport" evidence=IEA
GO:0005643 "nuclear pore" evidence=IEA
UNIPROTKB|E9PF10 NUP155 "Nuclear pore complex protein Nup155" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75694 NUP155 "Nuclear pore complex protein Nup155" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNT9 NUP155 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPS0 NUP155 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN95 NUP155 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6XTD9 NUP155 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2181182 Nup155 "nucleoporin 155" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-711 nup155 "nucleoporin 155" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNT1 NUP155 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
COG5308 1263 COG5308, NUP170, Nuclear pore complex subunit [Int 3e-14
pfam08801 411 pfam08801, Nucleoporin_N, Nup133 N terminal like 4e-10
>gnl|CDD|227624 COG5308, NUP170, Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score = 67.3 bits (164), Expect = 3e-14
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 3   VVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICI 62
           + F G  D N+YE+ Y+   SWF++ CSK+CLT S L+ +LP+F +  I  E ++ Q+ +
Sbjct: 195 IFFGGENDPNVYELVYKSSDSWFNSKCSKICLTKSILSSLLPSFFSFGIPGE-TIKQLAV 253

Query: 63  DNSRNVLYTRSELGLISVYDLYERG 87
           D SR +LY   +   +  Y + + G
Sbjct: 254 DQSRGLLYVLRKKSAVRAYSITKNG 278

Length = 1263
>gnl|CDD|220023 pfam08801, Nucleoporin_N, Nup133 N terminal like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
KOG1900|consensus 1311 99.97
COG5308 1263 NUP170 Nuclear pore complex subunit [Intracellular 99.91
PF08801 422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 99.74
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 93.87
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.06
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 91.52
KOG0646|consensus 476 90.92
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 89.98
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 88.65
KOG0646|consensus 476 88.54
smart0032040 WD40 WD40 repeats. Note that these repeats are per 85.44
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 84.57
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.07
KOG0649|consensus 325 83.36
KOG1272|consensus 545 82.75
>KOG1900|consensus Back     alignment and domain information 
Probab=99.97  E-value=6e-32  Score=246.96  Aligned_cols=109  Identities=42%  Similarity=0.722  Sum_probs=103.2

Q ss_pred             ceEEEecCCCCEEEEEEecCCCccccccceEEecCCcccccchhhhhhhccCCCceeEEEEeCCCceEEEecCCCeEEEE
Q psy7671           2 IVVFMGGTDGNLYEIKYQRDASWFSASCSKVCLTSSSLTYILPTFINALITQEDSLAQICIDNSRNVLYTRSELGLISVY   81 (115)
Q Consensus         2 GRIF~gG~DG~lyEl~Y~~~~~Wf~~kc~kinhT~~~~ssllPs~~~~~~~~~~~I~qi~vD~sR~lLYtLs~~s~I~vy   81 (115)
                      |||||||+|||||||.||.++|||++||+|||||+|.+++++|++++..++++|+|.||+||++|++||+|+++|+|++|
T Consensus       190 GRIF~~G~dg~lyEl~Yq~~~gWf~~rc~Kiclt~s~ls~lvPs~~~~~~~~~dpI~qi~ID~SR~IlY~lsek~~v~~Y  269 (1311)
T KOG1900|consen  190 GRIFFAGRDGNLYELVYQAEDGWFGSRCRKICLTKSVLSSLVPSLLSVPGSSKDPIRQITIDNSRNILYVLSEKGTVSAY  269 (1311)
T ss_pred             CcEEEeecCCCEEEEEEeccCchhhcccccccCchhHHHHhhhhhhcCCCCCCCcceeeEeccccceeeeeccCceEEEE
Confidence            99999999999999999999999999999999999999999999887533678999999999999999999999999999


Q ss_pred             EecCCCCceeeEEEecHHHHHHHHHhhhh
Q psy7671          82 DLYERGQGFRSLVSLSEEMIVQQALKFHI  110 (115)
Q Consensus        82 ~Lg~~g~~~~~v~s~s~~~i~~~a~~~~~  110 (115)
                      ++|++|....+..++++..|..+|+..-.
T Consensus       270 ~i~~~G~~~~r~~~~~~~~i~~qa~~~~~  298 (1311)
T KOG1900|consen  270 DIGGNGLGGPRFVSVSRNYIDVQALSLKN  298 (1311)
T ss_pred             EccCCCccceeeeehhHHHHHHHhhhccc
Confidence            99999999999999999999999987654

>COG5308 NUP170 Nuclear pore complex subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 95.38
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 91.94
3jrp_A379 Fusion protein of protein transport protein SEC13 91.62
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.6
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.27
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 91.04
4gz8_A 667 Semaphorin-3A; multi-domain, cell-CELL signaling, 90.7
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.21
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.16
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 90.13
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 89.69
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 89.45
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 89.39
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 89.22
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 89.06
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 88.72
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 88.68
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 87.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 87.66
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 87.65
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 87.33
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 87.25
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 86.94
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 86.59
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 86.49
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 86.27
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 85.65
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 85.38
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 85.25
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 85.23
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 85.19
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 84.49
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 84.39
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 84.36
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 83.75
3jrp_A 379 Fusion protein of protein transport protein SEC13 83.75
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 83.73
1q47_A495 Semaphorin 3A; beta propeller, signaling protein; 83.42
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 83.31
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 83.08
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 83.03
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 82.35
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 82.26
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 82.11
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 82.08
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 82.05
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 81.77
3ow8_A321 WD repeat-containing protein 61; structural genomi 80.85
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 80.76
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 80.73
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 80.58
2pm7_B 297 Protein transport protein SEC13, protein transport 80.53
3ow8_A321 WD repeat-containing protein 61; structural genomi 80.47
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 80.43
4g56_B357 MGC81050 protein; protein arginine methyltransfera 80.14
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
Probab=95.38  E-value=0.14  Score=36.20  Aligned_cols=45  Identities=7%  Similarity=0.223  Sum_probs=38.0

Q ss_pred             CCCceeEEEEeCCCceEEEecCCCeEEEEEecCCCCceeeEEEecH
Q psy7671          53 QEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQGFRSLVSLSE   98 (115)
Q Consensus        53 ~~~~I~qi~vD~sR~lLYtLs~~s~I~vy~Lg~~g~~~~~v~s~s~   98 (115)
                      ...+|..+...+..+.|.+-+.+++|++|++..++ .+..+..++.
T Consensus       305 h~~~v~~~~~s~~~~~l~s~~~dg~v~iw~~~~~~-~~~~~~~~~~  349 (351)
T 3f3f_A          305 HNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSN-EFKCMSVITA  349 (351)
T ss_dssp             TSSCEEEEEECSSSCCEEEEETTSCEEEEEECTTS-CEEEEEEEC-
T ss_pred             ccccEEEEEEcCCCCEEEEecCCCcEEEEecCcCc-chhheeehcc
Confidence            46789999999999999999999999999997643 6777777764
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4gz8_A Semaphorin-3A; multi-domain, cell-CELL signaling, plexin, glycosilate extracellular, signaling protein; HET: NAG BMA MAN; 3.30A {Mus musculus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1q47_A Semaphorin 3A; beta propeller, signaling protein; HET: NAG; 2.80A {Mus musculus} SCOP: b.69.12.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 93.72
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 92.19
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 91.56
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.23
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 90.01
d1q47a_495 Semaphorin 3a {Mouse (Mus musculus) [TaxId: 10090] 89.71
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 89.6
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 89.24
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.9
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.29
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 86.3
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 86.2
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 85.28
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 84.4
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 83.36
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 83.31
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.69
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 81.85
d1olza2478 Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} 81.27
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: Cell cycle arrest protein BUB3
domain: Cell cycle arrest protein BUB3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.72  E-value=0.078  Score=35.15  Aligned_cols=37  Identities=24%  Similarity=0.316  Sum_probs=32.8

Q ss_pred             cCCCceeEEEEeCCCceEEEecCCCeEEEEEecCCCC
Q psy7671          52 TQEDSLAQICIDNSRNVLYTRSELGLISVYDLYERGQ   88 (115)
Q Consensus        52 ~~~~~I~qi~vD~sR~lLYtLs~~s~I~vy~Lg~~g~   88 (115)
                      ..+|.|..|...+..+.|.|=+.+++|++|++...+.
T Consensus         9 ~h~d~I~~l~fsp~~~~L~s~s~Dg~v~iwd~~~~~~   45 (342)
T d1yfqa_           9 APKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAK   45 (342)
T ss_dssp             CCSSCEEEEEEEGGGTEEEEEETTSEEEEEEEETTTT
T ss_pred             CCCCCEEEEEEeCCCCEEEEEECCCeEEEEEccCCCc
Confidence            4678999999999999999999999999999976543
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q47a_ b.69.12.1 (A:) Semaphorin 3a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza2 b.69.12.1 (A:3-480) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure