Diaphorina citri psyllid: psy7680


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MSFSSISLCFLLCWVGCTTPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV
cccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEEccccccccccccEEEEEcccccccc
***SSISLCFLLCWVGCTTPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFSSISLCFLLCWVGCTTPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0003674 [MF]molecular_functionprobable
GO:0008150 [BP]biological_processprobable
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UWY, chain A
Confidence level:very confident
Coverage over the Query: 34-102
View the alignment between query and template
View the model in PyMOL
Template: 3MN8, chain A
Confidence level:very confident
Coverage over the Query: 25-102
View the alignment between query and template
View the model in PyMOL