Psyllid ID: psy7680
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| 91084647 | 1366 | PREDICTED: similar to AGAP002414-PA [Tri | 0.921 | 0.068 | 0.469 | 4e-17 | |
| 270009281 | 909 | carboxypeptidase A [Tribolium castaneum] | 0.921 | 0.103 | 0.469 | 5e-17 | |
| 170047837 | 259 | conserved hypothetical protein [Culex qu | 0.803 | 0.316 | 0.494 | 2e-14 | |
| 403183363 | 1457 | AAEL017499-PA [Aedes aegypti] | 0.921 | 0.064 | 0.44 | 3e-14 | |
| 332374584 | 433 | unknown [Dendroctonus ponderosae] | 0.715 | 0.168 | 0.540 | 1e-13 | |
| 242015953 | 1268 | carboxypeptidase D precursor, putative [ | 0.823 | 0.066 | 0.447 | 2e-13 | |
| 24638882 | 1406 | silver, isoform B [Drosophila melanogast | 0.960 | 0.069 | 0.42 | 2e-13 | |
| 45553831 | 1439 | silver, isoform G [Drosophila melanogast | 0.960 | 0.068 | 0.42 | 2e-13 | |
| 45553847 | 435 | silver, isoform F [Drosophila melanogast | 0.960 | 0.225 | 0.42 | 2e-13 | |
| 974553 | 1119 | carboxypeptidase precursor [Drosophila m | 0.960 | 0.087 | 0.42 | 2e-13 |
| >gi|91084647|ref|XP_966816.1| PREDICTED: similar to AGAP002414-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 4e-17, Method: Compositional matrix adjust.
Identities = 46/98 (46%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
Query: 5 SISLCFLLCWVGCTTPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGK 64
S ++ LL V + +++ E FL +P Y ++DELT ++P VKLHS+G+
Sbjct: 3 SKAIILLLVLVSSESQSILD---ESFLTSPKYHTYDELTNLFKKLETEHPEIVKLHSVGR 59
Query: 65 SVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV 102
SV+NR+LWAL+I+ NVA+ R L+ PMFKYVAN+HGDE
Sbjct: 60 SVRNRELWALEINANVAN-RTLMTPMFKYVANMHGDEA 96
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270009281|gb|EFA05729.1| carboxypeptidase A [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170047837|ref|XP_001851414.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870106|gb|EDS33489.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|403183363|gb|EJY58039.1| AAEL017499-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332374584|gb|AEE62433.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|242015953|ref|XP_002428607.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] gi|212513251|gb|EEB15869.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|24638882|ref|NP_525032.2| silver, isoform B [Drosophila melanogaster] gi|13124695|sp|P42787.2|CBPD_DROME RecName: Full=Carboxypeptidase D; AltName: Full=Metallocarboxypeptidase D; AltName: Full=Protein silver; Flags: Precursor gi|2827477|emb|CAA15634.1| EG:171D11.3 [Drosophila melanogaster] gi|10728354|gb|AAF45514.2| silver, isoform B [Drosophila melanogaster] gi|25137581|gb|AAN73046.1| carboxypeptidase D isoform 1B long tail-1 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|45553831|ref|NP_996319.1| silver, isoform G [Drosophila melanogaster] gi|25137583|gb|AAN73047.1| carboxypeptidase D isoform 1B long tail-2 [Drosophila melanogaster] gi|45446763|gb|AAS65239.1| silver, isoform G [Drosophila melanogaster] gi|257286275|gb|ACV53084.1| LD28490p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|45553847|ref|NP_996320.1| silver, isoform F [Drosophila melanogaster] gi|301598619|pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short gi|301598620|pdb|3MN8|B Chain B, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short gi|301598621|pdb|3MN8|C Chain C, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short gi|301598622|pdb|3MN8|D Chain D, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short gi|25137587|gb|AAN73049.1| carboxypeptidase D isoform 1B short [Drosophila melanogaster] gi|45446764|gb|AAS65240.1| silver, isoform F [Drosophila melanogaster] gi|261278417|gb|ACX61594.1| LP15968p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|974553|gb|AAA91650.1| carboxypeptidase precursor [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| FB|FBgn0004648 | 1406 | svr "silver" [Drosophila melan | 0.735 | 0.053 | 0.473 | 5e-13 | |
| ZFIN|ZDB-GENE-081112-2 | 1350 | cpda "carboxypeptidase D, a" [ | 0.647 | 0.048 | 0.439 | 3.9e-11 | |
| DICTYBASE|DDB_G0288963 | 544 | DDB_G0288963 "peptidase M14 fa | 0.813 | 0.152 | 0.372 | 1.6e-09 | |
| FB|FBgn0030778 | 527 | CG4678 [Drosophila melanogaste | 0.725 | 0.140 | 0.414 | 2.5e-09 | |
| UNIPROTKB|F8VVI6 | 136 | CPM "Carboxypeptidase M" [Homo | 0.784 | 0.588 | 0.409 | 2.9e-09 | |
| UNIPROTKB|A7MBD9 | 442 | CPM "Uncharacterized protein" | 0.588 | 0.135 | 0.524 | 4.9e-09 | |
| UNIPROTKB|F8W111 | 249 | CPM "Carboxypeptidase M" [Homo | 0.784 | 0.321 | 0.409 | 5.5e-09 | |
| RGD|1310532 | 443 | Cpm "carboxypeptidase M" [Ratt | 0.784 | 0.180 | 0.409 | 1.3e-08 | |
| MGI|MGI:1917824 | 443 | Cpm "carboxypeptidase M" [Mus | 0.784 | 0.180 | 0.409 | 1.7e-08 | |
| UNIPROTKB|P14384 | 443 | CPM "Carboxypeptidase M" [Homo | 0.784 | 0.180 | 0.409 | 2.2e-08 |
| FB|FBgn0004648 svr "silver" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 186 (70.5 bits), Expect = 5.0e-13, P = 5.0e-13
Identities = 36/76 (47%), Positives = 51/76 (67%)
Query: 26 DPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRN 85
+ E FL+ PHY S ++L + P++ K+H +G+S++ R+L ALQISRN S RN
Sbjct: 30 EDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRNTRS-RN 88
Query: 86 LLKPMFKYVANIHGDE 101
LL P KY+AN+HGDE
Sbjct: 89 LLTPPVKYIANMHGDE 104
|
|
| ZFIN|ZDB-GENE-081112-2 cpda "carboxypeptidase D, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288963 DDB_G0288963 "peptidase M14 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030778 CG4678 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VVI6 CPM "Carboxypeptidase M" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MBD9 CPM "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W111 CPM "Carboxypeptidase M" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1310532 Cpm "carboxypeptidase M" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917824 Cpm "carboxypeptidase M" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14384 CPM "Carboxypeptidase M" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| cd03868 | 293 | cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase | 5e-26 | |
| cd03858 | 293 | cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep | 1e-22 | |
| smart00631 | 277 | smart00631, Zn_pept, Zn_pept domain | 2e-19 | |
| cd03859 | 297 | cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T | 1e-15 | |
| pfam00246 | 277 | pfam00246, Peptidase_M14, Zinc carboxypeptidase | 2e-15 | |
| cd06905 | 360 | cd06905, M14-like_8, Peptidase M14-like domain; un | 3e-15 | |
| cd03863 | 296 | cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas | 3e-11 | |
| cd03866 | 292 | cd03866, M14_CPM, Peptidase M14 carboxypeptidase s | 5e-11 | |
| cd03860 | 293 | cd03860, M14_CP_A-B_like, Peptidase M14 carboxypep | 2e-10 | |
| cd03864 | 313 | cd03864, M14_CPN, Peptidase M14 carboxypeptidase s | 4e-10 | |
| cd06245 | 284 | cd06245, M14_CPD_III, Peptidase M14 carboxypeptida | 2e-08 | |
| cd03867 | 315 | cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s | 4e-08 | |
| cd03865 | 323 | cd03865, M14_CPE, Peptidase M14 carboxypeptidase s | 1e-07 | |
| cd03869 | 326 | cd03869, M14_CPX_like, Peptidase M14 carboxypeptid | 8e-07 | |
| cd06248 | 303 | cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxyp | 3e-05 |
| >gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup | Back alignment and domain information |
|---|
Score = 97.0 bits (242), Expect = 5e-26
Identities = 37/67 (55%), Positives = 46/67 (68%), Gaps = 1/67 (1%)
Query: 36 YLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVA 95
Y +DELT L + + P +LHSIG+SV+ RDLWAL+IS NV S R +PMFKYV
Sbjct: 1 YHHYDELTDLLASLEKAYPDIARLHSIGRSVEGRDLWALRISDNVNS-REPGRPMFKYVG 59
Query: 96 NIHGDEV 102
N+HGDE
Sbjct: 60 NMHGDET 66
|
The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain I. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active at pH 6.3-7.5 and prefers substrates with C-terminal Arg, whereas domain II is active at pH 5.0-6.5 and prefers substrates with C-terminal Lys. This Domain I family contains two contiguous surface cysteines that may become palmitoylated and target the enzyme to membranes, thus regulating intracellular trafficking. CPD functions in the processing of proteins that transit the secretory pathway, and is present in all vertebrates as well as Drosophila. It is broadly distributed in all tissue types. Within cells, CPD is present in the trans Golgi network and immature secretory vesicles, but is excluded from mature vesicles. It is thought to play a role in the processing of proteins that are initially processed by furin or related endopeptidases present in the trans Golgi network, such as growth factors and receptors. CPD is implicated in the pathogenesis of lupus erythematosus (LE), it is regulated by TGF-beta in various cell types of murine and human origin and is significantly down-regulated in CD14 positive cells isolated from patients with LE. As down-regulation of CPD leads to down-modulation of TGF-beta, CPD may have a role in a positive feedback loop. In D. melanogaster, the CPD variant 1B short (DmCPD1Bs) is necessary and sufficient for viability of the fruit fly. Length = 293 |
| >gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like | Back alignment and domain information |
|---|
| >gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain | Back alignment and domain information |
|---|
| >gnl|CDD|199843 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase | Back alignment and domain information |
|---|
| >gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily A/B-like | Back alignment and domain information |
|---|
| >gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase subfamily A/B-like; uncharacterized subgroup | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| cd06245 | 363 | M14_CPD_III The third carboxypeptidase (CP)-like d | 99.81 | |
| cd03869 | 405 | M14_CPX_like Peptidase M14-like domain of carboxyp | 99.8 | |
| cd03865 | 402 | M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C | 99.8 | |
| cd03863 | 375 | M14_CPD_II The second carboxypeptidase (CP)-like d | 99.79 | |
| cd03867 | 395 | M14_CPZ Peptidase M14-like domain of carboxypeptid | 99.79 | |
| cd06246 | 300 | M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C | 99.79 | |
| cd03871 | 300 | M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel | 99.78 | |
| cd06905 | 360 | Peptidase_M14-like_8 A functionally uncharacterize | 99.78 | |
| cd06247 | 298 | M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO | 99.78 | |
| cd03868 | 372 | M14_CPD_I The first carboxypeptidase (CP)-like dom | 99.78 | |
| cd03866 | 376 | M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM | 99.77 | |
| cd06248 | 304 | M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ | 99.77 | |
| cd03870 | 301 | M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA | 99.77 | |
| cd03864 | 392 | M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als | 99.77 | |
| cd03859 | 295 | M14_CPT Peptidase M14-like domain of carboxypeptid | 99.75 | |
| cd03858 | 374 | M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub | 99.75 | |
| cd03872 | 300 | M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know | 99.75 | |
| KOG2650|consensus | 418 | 99.72 | ||
| cd03860 | 294 | M14_CP_A-B_like The Peptidase M14 Carboxypeptidase | 99.7 | |
| smart00631 | 277 | Zn_pept Zn_pept. | 99.69 | |
| cd06242 | 268 | Peptidase_M14-like_1_5 Peptidase M14-like domain o | 99.69 | |
| KOG2649|consensus | 500 | 99.64 | ||
| PF00246 | 279 | Peptidase_M14: Zinc carboxypeptidase This is famil | 99.59 | |
| cd06227 | 272 | Peptidase_M14-like_2 A functionally uncharacterize | 99.57 | |
| cd06237 | 244 | M14_Nna1_like_3 A bacterial subgroup of the Peptid | 99.48 | |
| cd06234 | 263 | M14_Nna1_like_1 A bacterial subgroup of the Peptid | 99.41 | |
| cd06241 | 266 | Peptidase_M14-like_1_4 Peptidase M14-like domain o | 99.4 | |
| cd06908 | 261 | M14_AGBL4_like Peptidase M14-like domain of ATP/GT | 99.38 | |
| cd06226 | 293 | M14_CPT_like Peptidase M14-like domain of an uncha | 99.25 | |
| cd06239 | 231 | Peptidase_M14-like_1_2 Peptidase M14-like domain o | 99.2 | |
| cd03856 | 269 | M14_Nna1_like Peptidase M14-like domain of Nna-1 ( | 99.09 | |
| cd06240 | 273 | Peptidase_M14-like_1_3 Peptidase M14-like domain o | 98.97 | |
| cd06235 | 258 | M14_Nna1_like_2 Subgroup of the Peptidase M14-like | 98.94 | |
| cd06243 | 236 | Peptidase_M14-like_1_6 Peptidase M14-like domain o | 98.92 | |
| cd03857 | 226 | Peptidase_M14-like_1 Peptidase M14-like domain of | 98.91 | |
| cd06907 | 261 | M14_AGBL2-3_like Peptidase M14-like domain of ATP/ | 98.89 | |
| cd06236 | 304 | M14_AGBL5_like Peptidase M14-like domain of ATP/GT | 98.75 | |
| cd06228 | 332 | Peptidase_M14-like_3 A functionally uncharacterize | 98.72 | |
| cd06238 | 271 | Peptidase_M14-like_1_1 Peptidase M14-like domain o | 98.59 | |
| PRK10602 | 237 | murein peptide amidase A; Provisional | 98.57 | |
| cd06244 | 268 | Peptidase_M14-like_1_7 Peptidase M14-like domain o | 98.42 | |
| cd06232 | 240 | Peptidase_M14-like_5 Peptidase M14-like domain of | 98.38 | |
| cd06906 | 278 | M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo | 98.32 | |
| cd06231 | 236 | Peptidase_M14-like_4 A functionally uncharacterize | 98.03 | |
| cd03862 | 273 | Peptidase_M14-like_7 A functionally uncharacterize | 97.22 | |
| COG2866 | 374 | Predicted carboxypeptidase [Amino acid transport a | 96.1 | |
| KOG3641|consensus | 650 | 95.54 | ||
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 95.2 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 94.64 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 94.2 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 94.17 | |
| cd06233 | 283 | Peptidase_M14-like_6 Peptidase M14-like domain of | 94.17 | |
| cd03855 | 322 | M14_ASTE Peptidase M14 Succinylglutamate desucciny | 92.52 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 92.2 | |
| PRK05324 | 329 | succinylglutamate desuccinylase; Provisional | 92.19 | |
| COG2988 | 324 | Succinylglutamate desuccinylase [Amino acid transp | 91.38 | |
| TIGR03242 | 319 | arg_catab_astE succinylglutamate desuccinylase. Me | 91.22 | |
| cd06256 | 327 | M14_ASTE_ASPA_like_6 A functionally uncharacterize | 91.05 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 88.13 | |
| cd06229 | 255 | M14_Endopeptidase_I Peptidase M14-like domain of G | 86.35 |
| >cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
Probab=99.81 E-value=8.2e-20 Score=139.21 Aligned_cols=67 Identities=31% Similarity=0.545 Sum_probs=62.4
Q ss_pred CCCCHHHHHHHHHHHHHhCCCCeEEEEccccCCCceEEEEEEecCCCCCCCCCCceEEEEccccCCCC
Q psy7680 35 HYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV 102 (102)
Q Consensus 35 ~y~~~~ei~~~l~~la~~~p~~v~~~~iG~S~eGR~i~~l~is~~~~~~~~~~kp~v~i~ggiHg~E~ 102 (102)
+||+|+||.+||++|+++||+++++.+||+|+|||+|++++|+++++ ...++||.|+++|+|||||.
T Consensus 1 ~Yh~y~ei~~~l~~l~~~~p~i~~l~~IG~S~eGR~l~~l~Is~~~~-~~~~~kp~v~~~~giHg~E~ 67 (363)
T cd06245 1 RYHHYKELSEFLRGLTLNYPHITNLTSLGQSVEFRPILSLEISNKPN-NSEPEEPKIRFVAGIHGNAP 67 (363)
T ss_pred CCCCHHHHHHHHHHHHHHCCCceEEEEeeecCCCceEEEEEecCCCC-CCCCCCCEEEEECCccCCcH
Confidence 59999999999999999999999999999999999999999998664 45668999999999999995
|
4.17.22), domain III. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active a |
| >cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 | Back alignment and domain information |
|---|
| >cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 | Back alignment and domain information |
|---|
| >cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E | Back alignment and domain information |
|---|
| >cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 | Back alignment and domain information |
|---|
| >cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 | Back alignment and domain information |
|---|
| >KOG2650|consensus | Back alignment and domain information |
|---|
| >cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily | Back alignment and domain information |
|---|
| >smart00631 Zn_pept Zn_pept | Back alignment and domain information |
|---|
| >cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >KOG2649|consensus | Back alignment and domain information |
|---|
| >PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification | Back alignment and domain information |
|---|
| >cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins | Back alignment and domain information |
|---|
| >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins | Back alignment and domain information |
|---|
| >cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins | Back alignment and domain information |
|---|
| >cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins | Back alignment and domain information |
|---|
| >cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins | Back alignment and domain information |
|---|
| >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins | Back alignment and domain information |
|---|
| >cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >PRK10602 murein peptide amidase A; Provisional | Back alignment and domain information |
|---|
| >cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PRK05324 succinylglutamate desuccinylase; Provisional | Back alignment and domain information |
|---|
| >COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03242 arg_catab_astE succinylglutamate desuccinylase | Back alignment and domain information |
|---|
| >cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 102 | ||||
| 3mn8_A | 435 | Structure Of Drosophila Melanogaster Carboxypeptida | 4e-15 | ||
| 1uwy_A | 426 | Crystal Structure Of Human Carboxypeptidase M Lengt | 4e-09 | ||
| 1qmu_A | 380 | Duck Carboxypeptidase D Domain Ii Length = 380 | 3e-08 | ||
| 2nsm_A | 439 | Crystal Structure Of The Human Carboxypeptidase N ( | 6e-06 | ||
| 3prt_A | 323 | Mutant Of The Carboxypeptidase T Length = 323 | 1e-05 | ||
| 3v38_A | 326 | Carboxypeptidase T Mutant L254n Length = 326 | 1e-05 | ||
| 1obr_A | 326 | Carboxypeptidase T Length = 326 | 1e-05 | ||
| 3qnv_A | 323 | Carboxypeptidase T Length = 323 | 1e-05 |
| >pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short Length = 435 | Back alignment and structure |
|
| >pdb|1UWY|A Chain A, Crystal Structure Of Human Carboxypeptidase M Length = 426 | Back alignment and structure |
| >pdb|1QMU|A Chain A, Duck Carboxypeptidase D Domain Ii Length = 380 | Back alignment and structure |
| >pdb|2NSM|A Chain A, Crystal Structure Of The Human Carboxypeptidase N (kininase I) Catalytic Domain Length = 439 | Back alignment and structure |
| >pdb|3PRT|A Chain A, Mutant Of The Carboxypeptidase T Length = 323 | Back alignment and structure |
| >pdb|3V38|A Chain A, Carboxypeptidase T Mutant L254n Length = 326 | Back alignment and structure |
| >pdb|1OBR|A Chain A, Carboxypeptidase T Length = 326 | Back alignment and structure |
| >pdb|3QNV|A Chain A, Carboxypeptidase T Length = 323 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 2e-22 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 2e-21 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 1e-20 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 4e-20 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 4e-18 | |
| 2c1c_A | 312 | Carboxypeptidase B; insect, metalloprotease, insen | 2e-13 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 6e-13 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 6e-12 | |
| 1pca_A | 403 | Procarboxypeptidase A PCPA; hydrolase(C-terminal p | 7e-12 | |
| 1z5r_A | 306 | Procarboxypeptidase B; exopeptidase, hydrolase; 1. | 8e-12 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 1e-11 | |
| 3d4u_A | 309 | Tafia, carboxypeptidase B2; protease-inhibitor com | 2e-11 | |
| 1kwm_A | 402 | Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A | 2e-11 | |
| 3dgv_A | 401 | TAFI, carboxypeptidase B2; blood coagulation, fibr | 3e-11 | |
| 2boa_A | 404 | Carboxypeptidase A4; metalloprocarboxypeptidase, X | 4e-11 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 1e-10 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 2e-10 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 3e-04 |
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 | Back alignment and structure |
|---|
Score = 88.8 bits (220), Expect = 2e-22
Identities = 39/104 (37%), Positives = 56/104 (53%), Gaps = 9/104 (8%)
Query: 7 SLCFLLCWVGCT--------TPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVK 58
+L L +G + E FL+ PHY S ++L + P++ K
Sbjct: 3 TLGLLFASIGIAVLAMGVPHCRGYTIKEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAK 62
Query: 59 LHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV 102
+H +G+S++ R+L ALQISRN S RNLL P KY+AN+HGDE
Sbjct: 63 VHFLGRSLEGRNLLALQISRNTRS-RNLLTPPVKYIANMHGDET 105
|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 | Back alignment and structure |
|---|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 | Back alignment and structure |
|---|
| >2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Length = 312 | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Length = 307 | Back alignment and structure |
|---|
| >1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Length = 403 | Back alignment and structure |
|---|
| >1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Length = 306 | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Length = 308 | Back alignment and structure |
|---|
| >3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Length = 309 | Back alignment and structure |
|---|
| >1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Length = 402 | Back alignment and structure |
|---|
| >3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Length = 401 | Back alignment and structure |
|---|
| >2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Length = 404 | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 99.85 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 99.78 | |
| 3v38_A | 326 | Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th | 99.78 | |
| 2c1c_A | 312 | Carboxypeptidase B; insect, metalloprotease, insen | 99.78 | |
| 1z5r_A | 306 | Procarboxypeptidase B; exopeptidase, hydrolase; 1. | 99.76 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 99.76 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 99.76 | |
| 3d4u_A | 309 | Tafia, carboxypeptidase B2; protease-inhibitor com | 99.76 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 99.76 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 99.75 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 99.75 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 99.75 | |
| 3dgv_A | 401 | TAFI, carboxypeptidase B2; blood coagulation, fibr | 99.74 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 99.73 | |
| 2boa_A | 404 | Carboxypeptidase A4; metalloprocarboxypeptidase, X | 99.73 | |
| 1kwm_A | 402 | Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A | 99.73 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 99.71 | |
| 1pca_A | 403 | Procarboxypeptidase A PCPA; hydrolase(C-terminal p | 99.64 | |
| 2qvp_A | 275 | Uncharacterized protein; putative metallopeptidase | 99.54 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 99.51 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 99.48 | |
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 99.46 | |
| 4axv_A | 243 | MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | 98.99 | |
| 3b2y_A | 275 | Metallopeptidase containing CO-catalytic metalloa | 98.58 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 97.37 | |
| 1yw6_A | 335 | Succinylglutamate desuccinylase; alpha-beta protei | 97.34 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 97.02 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 95.27 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 94.54 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 93.84 | |
| 1yw4_A | 341 | Succinylglutamate desuccinylase; alpha-beta protei | 92.93 | |
| 3nh4_A | 327 | Aspartoacylase-2; mercapturates, hydrolase; 2.00A | 90.95 |
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=99.85 E-value=5.4e-21 Score=147.13 Aligned_cols=99 Identities=40% Similarity=0.717 Sum_probs=70.2
Q ss_pred CCccchhHHHHHH-HhhcCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCeEEEEccccCCCceEEEEEEecC
Q psy7680 1 MSFSSISLCFLLC-WVGCTTPVLVNNDPEPFLENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRN 79 (102)
Q Consensus 1 ~~~~~~~~~~~~~-~~~c~~p~~~~~~~~~~~~~~~y~~~~ei~~~l~~la~~~p~~v~~~~iG~S~eGR~i~~l~is~~ 79 (102)
|-|.++++..++. +.+|..|.. +++.+|.++..||+|+||.+||++|+++||+++++.+||+|+|||+|++++|+++
T Consensus 6 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~Y~~~~ei~~~l~~l~~~~p~~~~~~~iG~S~eGR~i~~l~is~~ 83 (435)
T 3mn8_A 6 LLFASIGIAVLAMGVPHCRGYTI--KEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQISRN 83 (435)
T ss_dssp -------------------------CCCCGGGSSCCCCCHHHHHHHHHHHHHHSTTTEEEEEEEECTTSCEEEEEEECSC
T ss_pred hhHHHHHHHHHccccccccCCCC--CChhhccCCCCCCCHHHHHHHHHHHHHHCCCcEEEEEeeEccCCCEEEEEEEeCC
Confidence 4566666644443 455555533 3556888899999999999999999999999999999999999999999999987
Q ss_pred CCCCCCCCCceEEEEccccCCCC
Q psy7680 80 VASGRNLLKPMFKYVANIHGDEV 102 (102)
Q Consensus 80 ~~~~~~~~kp~v~i~ggiHg~E~ 102 (102)
++ ....+||.|+++|+|||||.
T Consensus 84 ~~-~~~~~kp~v~i~~giHg~E~ 105 (435)
T 3mn8_A 84 TR-SRNLLTPPVKYIANMHGDET 105 (435)
T ss_dssp TT-SCCTTCCEEEEECCSSTTCC
T ss_pred CC-ccccCCCEEEEEecCCCCCh
Confidence 65 45568999999999999995
|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A | Back alignment and structure |
|---|
| >3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A | Back alignment and structure |
|---|
| >2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* | Back alignment and structure |
|---|
| >3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* | Back alignment and structure |
|---|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 | Back alignment and structure |
|---|
| >2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A | Back alignment and structure |
|---|
| >1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A | Back alignment and structure |
|---|
| >2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} | Back alignment and structure |
|---|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* | Back alignment and structure |
|---|
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} | Back alignment and structure |
|---|
| >4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | Back alignment and structure |
|---|
| >3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 102 | ||||
| d1obra_ | 323 | c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce | 2e-16 | |
| d1m4la_ | 307 | c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) | 1e-15 | |
| d2c1ca1 | 312 | c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor | 2e-15 | |
| d1uwya2 | 296 | c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d | 4e-15 | |
| d1jqga1 | 317 | c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll | 5e-15 | |
| d1h8la2 | 301 | c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d | 6e-15 | |
| d2bo9a1 | 305 | c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo | 3e-14 | |
| d1z5ra1 | 304 | c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus sc | 3e-14 | |
| d1ayea1 | 307 | c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo | 4e-14 |
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Carboxypeptidase T domain: Carboxypeptidase T species: Thermoactinomyces vulgaris [TaxId: 2026]
Score = 70.7 bits (172), Expect = 2e-16
Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
Query: 35 HYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYV 94
Y +++E+ + A P+ VK SIGKS + R+LWA++IS NV + N +P Y
Sbjct: 8 GYHNYNEMVNKINTVASNYPNIVKKFSIGKSYEGRELWAVKISDNVGTDEN--EPEVLYT 65
Query: 95 ANIHGDEV 102
A H E
Sbjct: 66 ALHHAREH 73
|
| >d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 | Back information, alignment and structure |
|---|
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 | Back information, alignment and structure |
|---|
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 | Back information, alignment and structure |
|---|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Length = 304 | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| d1jqga1 | 317 | Carboxypeptidase A {Cotton bollworm (Helicoverpa a | 99.82 | |
| d1uwya2 | 296 | Carboxypeptidase M, catalytic domain {Human (Homo | 99.82 | |
| d2bo9a1 | 305 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.81 | |
| d1h8la2 | 301 | Carboxypeptidase D, catalytic domain {Crested duck | 99.81 | |
| d2c1ca1 | 312 | Carboxypeptidase B {Corn earworm (Helicoverpa zea) | 99.8 | |
| d1m4la_ | 307 | Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] | 99.8 | |
| d1obra_ | 323 | Carboxypeptidase T {Thermoactinomyces vulgaris [Ta | 99.8 | |
| d1z5ra1 | 304 | Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] | 99.79 | |
| d1ayea1 | 307 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.79 | |
| d1yw6a1 | 322 | Succinylglutamate desuccinylase AstE {Escherichia | 96.49 | |
| d2g9da1 | 340 | Succinylglutamate desuccinylase AstE {Vibrio chole | 92.24 | |
| d2bcoa1 | 339 | Succinylglutamate desuccinylase AstE {Vibrio parah | 92.07 | |
| d1yw4a1 | 331 | Succinylglutamate desuccinylase AstE {Chromobacter | 91.82 |
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase A species: Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]
Probab=99.82 E-value=3.6e-20 Score=135.85 Aligned_cols=69 Identities=25% Similarity=0.294 Sum_probs=64.5
Q ss_pred CCCCCCCHHHHHHHHHHHHHhCCCCeEEEEccccCCCceEEEEEEecCCCCCCCCCCceEEEEccccCCCC
Q psy7680 32 ENPHYLSFDELTKFLVAAAQQNPSKVKLHSIGKSVQNRDLWALQISRNVASGRNLLKPMFKYVANIHGDEV 102 (102)
Q Consensus 32 ~~~~y~~~~ei~~~l~~la~~~p~~v~~~~iG~S~eGR~i~~l~is~~~~~~~~~~kp~v~i~ggiHg~E~ 102 (102)
+|++||||+||.+||++|+++||+++++.+||+|+|||+|++++|++.. ..+..||+|+|+|++||||.
T Consensus 8 ~f~~Y~ty~ei~~~l~~la~~~p~~v~~~~iG~S~eGR~i~~l~I~~~~--~~~~~kp~v~i~~g~Hg~E~ 76 (317)
T d1jqga1 8 SFDKIHSYEEVDAYLQELAKEFPNVVTVVEGGKSFEGRSIKYLRISTTN--FQDASKPVVMMQSLLHCREW 76 (317)
T ss_dssp CSSSCCCHHHHHHHHHHHHHHCTTTEEEEEEEECTTCCEEEEEEECTTT--TCCTTSCEEEEEECSSTTCT
T ss_pred CCcCCCCHHHHHHHHHHHHHHCCCceEEEeccCCCCCCeEEEEEEecCC--CCCCCCcEEEEccccCcccc
Confidence 7899999999999999999999999999999999999999999999754 34568999999999999995
|
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} | Back information, alignment and structure |
|---|
| >d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|