Diaphorina citri psyllid: psy7684

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--

MSGHDMTLRNRPYPSSSTLKAADLLTEGVELTLGELEDMAVRQQAQIDSQRQLIAAKEQRLRFLKQHEARHQQVAAEHERLRRLRDRVEQQELKLRKLRALRGQVDQNKMNNISLSSDLESIRALFNEKEKELCMAVAKVEELTHQLEDLKRGRTHQPSHPHLSAELENLRRELMYHNKLSEQQNVRLHQQRETLTKKQAEVNSVDLRISELQERLQRKRLLNQQLASQLNSNINSSQHQLPPGKQQLVAQNSQLTSAHINNVNSLFRSMTSSNIAAVAPYLHVPSKPNLDNTHAIFQNQRRIESGHNQLNKVVCFDFVPEISEKCAVDEIQ

ccccccccccccccccHHHHHcccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHcccc

************************LTEGVELTLG***************************************************************************************IRALFNEKEKELCMAVAKVE*********************************************************************************************************************************TSSNIAAVAPYLHVPSKPNLDNTHAIFQNQRRIESGHNQLNKVVCFDFVPEISEKCAVD*I*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSGHDMTLRNRPYPSSSTLKAADLLTEGVELTLGELEDMAVRQQAQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRGQVDQNKMNNISLSSDLESIRALFNEKEKELCMAVAKVEELTHQLEDLKRGRTHQPSHPHLSAELENLRRELMYHNKLSEQQNVRLHQQRETxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNSNINSSQHQLPPGKQQLVAQNSQLTSAHINNVNSLFRSMTSSNIAAVAPYLHVPSKPNLDNTHAIFQNQRRIESGHNQLNKVVCFDFVPEISEKCAVDEIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030296 [MF]	protein tyrosine kinase activator activity	probable	GO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047, GO:0030295
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 33-108
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 36-98,140-255
View the alignment between query and template
View the model in PyMOL