Diaphorina citri psyllid: psy7685


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ
ccccccEEEcccccccccEEEEEccEEEEECcccccccccccccccccccccccccccHHHHHcccccccEEEECcccccccccccccccccEEEEEEccccccccccEEEEccEEEEEccccEECccccccccccc
****HIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHE*************EGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYP*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Apoptosis-stimulating of p53 protein 1 Regulator that plays a central role in regulation of apoptosis via its interaction with p53/TP53. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo.confidentQ62415

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0030296 [MF]protein tyrosine kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047, GO:0030295
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YCS, chain B
Confidence level:very confident
Coverage over the Query: 7-128
View the alignment between query and template
View the model in PyMOL