Psyllid ID: psy7685


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ
ccccccEEEcccccccccEEEEEccEEEEEEcccccccccccccccccccccccccccHHHHHcccccccEEEEEcccccccccccccccccEEEEEEccccccccccEEEEccEEEEEccccEEEccccccccccc
ccccHHEEEEEccccHHHHHHHHcccEcccccccccccHHHHccccccccccHHHHHHHHHHHccccHHHEEEEcccEccccccEccEccccEEEEccccccccccEEEEEEccEEEEEEHHHEEcccccccccccc
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFAtthsdhetaavkceedeegfeGCSEFLYSVQEKLgilnngavyalydyeanntdelsfktGECIIVLRKGDENEREWWWSKLnnkegyvprnllglyprvqpsatpq
mpkshiqkIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLnnkegyvprnllglyprvqpsatpq
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKceedeegfegcsefLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ
*****IQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYP*********
****HIQKIHFTCTTLAVCSLSFVLYCI*****************************************GAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGL***********
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHE*************EGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ
***SHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQ******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKSHIQKIHFTCTTLAVCSLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q624151087 Apoptosis-stimulating of yes N/A 0.883 0.111 0.606 6e-41
Q136251128 Apoptosis-stimulating of no N/A 0.883 0.107 0.573 5e-40
Q96KQ41090 Apoptosis-stimulating of no N/A 0.883 0.111 0.581 3e-39
Q8CG791128 Apoptosis-stimulating of no N/A 0.883 0.107 0.581 4e-31
Q8WUF5828 RelA-associated inhibitor no N/A 0.875 0.144 0.471 2e-30
Q5I1X5824 RelA-associated inhibitor no N/A 0.868 0.144 0.467 1e-29
Q9XVN3769 Apoptotic enhancer 1 prot yes N/A 0.759 0.135 0.462 3e-21
Q9NZM3 1697 Intersectin-2 OS=Homo sap no N/A 0.430 0.034 0.419 7e-07
P197061147 Myosin heavy chain IB OS= N/A N/A 0.364 0.043 0.490 1e-06
Q15811 1721 Intersectin-1 OS=Homo sap no N/A 0.430 0.034 0.403 4e-06
>sp|Q62415|ASPP1_MOUSE Apoptosis-stimulating of p53 protein 1 OS=Mus musculus GN=Ppp1r13b PE=1 SV=2 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/122 (60%), Positives = 95/122 (77%), Gaps = 1/122 (0%)

Query: 12   TCTTLAVC-SLSFVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNG 70
            +C ++ +C  L      IFA+T SD ETAA KCEE EEG+  CS+FLY VQEKLG++N G
Sbjct: 960  SCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKG 1019

Query: 71   AVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRV 130
             VYAL+DYEA N+DELSF  G+ I +LR+ DENE EWWW++L ++EGYVP+NLLGLYPR+
Sbjct: 1020 TVYALWDYEAQNSDELSFHEGDAITILRRKDENETEWWWARLGDREGYVPKNLLGLYPRI 1079

Query: 131  QP 132
            +P
Sbjct: 1080 KP 1081




Regulator that plays a central role in regulation of apoptosis via its interaction with p53/TP53. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo.
Mus musculus (taxid: 10090)
>sp|Q13625|ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens GN=TP53BP2 PE=1 SV=2 Back     alignment and function description
>sp|Q96KQ4|ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens GN=PPP1R13B PE=1 SV=3 Back     alignment and function description
>sp|Q8CG79|ASPP2_MOUSE Apoptosis-stimulating of p53 protein 2 OS=Mus musculus GN=Tp53bp2 PE=1 SV=3 Back     alignment and function description
>sp|Q8WUF5|IASPP_HUMAN RelA-associated inhibitor OS=Homo sapiens GN=PPP1R13L PE=1 SV=4 Back     alignment and function description
>sp|Q5I1X5|IASPP_MOUSE RelA-associated inhibitor OS=Mus musculus GN=Ppp1r13l PE=1 SV=1 Back     alignment and function description
>sp|Q9XVN3|IASPP_CAEEL Apoptotic enhancer 1 protein OS=Caenorhabditis elegans GN=ape-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 Back     alignment and function description
>sp|P19706|MYSB_ACACA Myosin heavy chain IB OS=Acanthamoeba castellanii GN=MIB PE=1 SV=2 Back     alignment and function description
>sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
307177764 1216 Apoptosis-stimulating of p53 protein 1 [ 0.795 0.089 0.798 1e-49
332018007 1074 Apoptosis-stimulating of p53 protein 1 [ 0.781 0.099 0.813 3e-49
307214808 1075 Apoptosis-stimulating of p53 protein 2 [ 0.781 0.099 0.813 2e-48
328785901 1329 PREDICTED: hypothetical protein LOC41022 0.781 0.080 0.794 7e-48
380029713 1308 PREDICTED: uncharacterized protein LOC10 0.781 0.081 0.794 7e-48
350400919 1292 PREDICTED: hypothetical protein LOC10074 0.781 0.082 0.794 1e-47
340719671 1289 PREDICTED: hypothetical protein LOC10064 0.781 0.083 0.794 1e-47
383862741 1287 PREDICTED: uncharacterized protein LOC10 0.781 0.083 0.794 1e-47
328722181 1041 PREDICTED: hypothetical protein LOC10016 0.759 0.099 0.778 5e-46
270005081 891 hypothetical protein TcasGA2_TC007089 [T 0.781 0.120 0.794 1e-45
>gi|307177764|gb|EFN66761.1| Apoptosis-stimulating of p53 protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/109 (79%), Positives = 99/109 (90%)

Query: 27   CIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDEL 86
            CIFATT SDHETAA KCEEDEEGF+GCSE+LYSVQEKLGI+NNG VYA++DYEA + DEL
Sbjct: 1106 CIFATTLSDHETAAEKCEEDEEGFDGCSEYLYSVQEKLGIMNNGQVYAVFDYEAQHADEL 1165

Query: 87   SFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSAT 135
            S K G+ ++VLRKGD+NEREWWWSKL +KEGYVPRNLLGLYPRVQP+ T
Sbjct: 1166 SLKNGDSVVVLRKGDDNEREWWWSKLGHKEGYVPRNLLGLYPRVQPAKT 1214




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332018007|gb|EGI58636.1| Apoptosis-stimulating of p53 protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307214808|gb|EFN89695.1| Apoptosis-stimulating of p53 protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328785901|ref|XP_393703.4| PREDICTED: hypothetical protein LOC410220 [Apis mellifera] Back     alignment and taxonomy information
>gi|380029713|ref|XP_003698511.1| PREDICTED: uncharacterized protein LOC100870125 [Apis florea] Back     alignment and taxonomy information
>gi|350400919|ref|XP_003486003.1| PREDICTED: hypothetical protein LOC100743731 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719671|ref|XP_003398271.1| PREDICTED: hypothetical protein LOC100646232 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383862741|ref|XP_003706842.1| PREDICTED: uncharacterized protein LOC100877563 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328722181|ref|XP_001946955.2| PREDICTED: hypothetical protein LOC100161456 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270005081|gb|EFA01529.1| hypothetical protein TcasGA2_TC007089 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
UNIPROTKB|F1NWV91094 PPP1R13B "Uncharacterized prot 0.883 0.110 0.540 2.3e-30
UNIPROTKB|F1P2P11101 TP53BP2 "Uncharacterized prote 0.883 0.109 0.516 3.9e-30
UNIPROTKB|B7Z2E9367 TP53BP2 "cDNA FLJ50500, highly 0.883 0.329 0.491 4.9e-30
MGI|MGI:13361991087 Ppp1r13b "protein phosphatase 0.883 0.111 0.532 2.1e-29
RGD|1304651967 Ppp1r13b "protein phosphatase 0.883 0.125 0.532 2.8e-29
UNIPROTKB|D4A6A81042 Ppp1r13b "Protein Ppp1r13b" [R 0.883 0.116 0.532 3.2e-29
UNIPROTKB|F1S6421135 TP53BP2 "Uncharacterized prote 0.883 0.106 0.5 3.7e-29
UNIPROTKB|F1P9851124 TP53BP2 "Uncharacterized prote 0.883 0.107 0.5 4.7e-29
UNIPROTKB|F1MWG71134 TP53BP2 "Uncharacterized prote 0.883 0.106 0.5 4.8e-29
UNIPROTKB|Q136251128 TP53BP2 "Apoptosis-stimulating 0.883 0.107 0.491 9.9e-29
UNIPROTKB|F1NWV9 PPP1R13B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 2.3e-30, P = 2.3e-30
 Identities = 66/122 (54%), Positives = 84/122 (68%)

Query:    12 TCTTLAVCSLSFVL-YCIFATTHSDHETAAVKXXXXXXXXXXXXXXLYSVQEKLGILNNG 70
             +C ++ +C L       IFA+T SD ETAA K              LY VQEKLG++N G
Sbjct:   967 SCNSVHLCKLLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKG 1026

Query:    71 AVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRV 130
              VYAL+DYEA N DELSF  G+ I +LR+ D+NE EWWW++LN+KEGYVP+NLLGLYPR+
Sbjct:  1027 VVYALWDYEAQNNDELSFHEGDAITILRRKDDNETEWWWARLNDKEGYVPKNLLGLYPRI 1086

Query:   131 QP 132
             +P
Sbjct:  1087 KP 1088




GO:0005634 "nucleus" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0006917 "induction of apoptosis" evidence=IEA
UNIPROTKB|F1P2P1 TP53BP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z2E9 TP53BP2 "cDNA FLJ50500, highly similar to Apoptosis-stimulating of p53 protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1336199 Ppp1r13b "protein phosphatase 1, regulatory (inhibitor) subunit 13B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304651 Ppp1r13b "protein phosphatase 1, regulatory subunit 13B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6A8 Ppp1r13b "Protein Ppp1r13b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S642 TP53BP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P985 TP53BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWG7 TP53BP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q13625 TP53BP2 "Apoptosis-stimulating of p53 protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62415ASPP1_MOUSENo assigned EC number0.60650.88320.1113yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 3e-33
cd1195457 cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt 4e-27
cd1195357 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of 3e-26
cd1195256 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of 4e-19
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 3e-15
smart0032656 smart00326, SH3, Src homology 3 domains 7e-14
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 3e-13
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-12
cd1180057 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src 2e-11
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 2e-11
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 7e-11
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 8e-11
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 1e-10
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 1e-10
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 3e-10
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 3e-10
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 4e-10
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 4e-10
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 7e-10
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 1e-09
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 1e-09
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 2e-09
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 3e-09
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 3e-09
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 3e-09
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 4e-09
cd1194752 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do 6e-09
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 6e-09
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 7e-09
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 1e-08
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 1e-08
cd1202453 cd12024, SH3_NoxO1_2, Second or C-terminal Src hom 1e-08
cd1200168 cd12001, SH3_BCAR1, Src homology 3 domain of the C 1e-08
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 2e-08
cd1200362 cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr 2e-08
cd1214157 cd12141, SH3_DNMBP_C2, Second C-terminal Src homol 2e-08
cd1187658 cd11876, SH3_MLK, Src Homology 3 domain of Mixed L 2e-08
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 2e-08
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 2e-08
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 3e-08
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 5e-08
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 5e-08
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 5e-08
cd1177557 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain 6e-08
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 6e-08
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 7e-08
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 8e-08
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 9e-08
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 1e-07
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-07
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 1e-07
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 2e-07
cd1184456 cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr 2e-07
cd1180853 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain 2e-07
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 2e-07
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 2e-07
cd1184758 cd11847, SH3_Brk, Src homology 3 domain of Brk (Br 2e-07
cd1200456 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro 2e-07
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 2e-07
cd1200758 cd12007, SH3_Yes, Src homology 3 domain of Yes Pro 2e-07
cd1176157 cd11761, SH3_FCHSD_1, First Src Homology 3 domain 2e-07
cd1205858 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed 3e-07
cd1197373 cd11973, SH3_ASEF, Src homology 3 domain of APC-St 4e-07
cd1197562 cd11975, SH3_ARHGEF9, Src homology 3 domain of the 4e-07
cd1185855 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain 4e-07
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 5e-07
cd1187854 cd11878, SH3_Bem1p_1, First Src Homology 3 domain 6e-07
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 7e-07
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 8e-07
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 8e-07
cd1200057 cd12000, SH3_CASS4, Src homology 3 domain of CAS ( 8e-07
cd1199856 cd11998, SH3_PACSIN1-2, Src homology 3 domain of P 1e-06
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 1e-06
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 2e-06
cd1186653 cd11866, SH3_SKAP1-like, Src Homology 3 domain of 2e-06
cd1197454 cd11974, SH3_ASEF2, Src homology 3 domain of APC-S 2e-06
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 2e-06
cd1189456 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai 2e-06
cd1201262 cd12012, SH3_RIM-BP_2, Second Src homology 3 domai 2e-06
cd1190457 cd11904, SH3_Nck1_3, Third Src Homology 3 domain o 2e-06
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 2e-06
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 2e-06
cd1190655 cd11906, SH3_BTK, Src Homology 3 domain of Bruton' 3e-06
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 3e-06
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 4e-06
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 4e-06
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 4e-06
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 4e-06
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 4e-06
cd1200954 cd12009, SH3_Blk, Src homology 3 domain of Blk Pro 5e-06
cd1200554 cd12005, SH3_Lck, Src homology 3 domain of Lck Pro 5e-06
cd1200257 cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( 5e-06
cd1178753 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain 5e-06
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 5e-06
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 6e-06
cd1205253 cd12052, SH3_CIN85_1, First Src Homology 3 domain 7e-06
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 7e-06
cd1199756 cd11997, SH3_PACSIN3, Src homology 3 domain of Pro 8e-06
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 1e-05
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 1e-05
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 1e-05
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 1e-05
cd1194157 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src ho 1e-05
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 1e-05
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 1e-05
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 2e-05
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 2e-05
cd1196557 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA 2e-05
cd1176551 cd11765, SH3_Nck_1, First Src Homology 3 domain of 2e-05
cd1190856 cd11908, SH3_ITK, Src Homology 3 domain of Interle 2e-05
cd1200856 cd12008, SH3_Src, Src homology 3 domain of Src Pro 2e-05
cd1184953 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 2e-05
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 2e-05
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 2e-05
cd1204453 cd12044, SH3_SKAP1, Src Homology 3 domain of Src K 3e-05
cd1202153 cd12021, SH3_p47phox_1, First or N-terminal Src ho 3e-05
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 3e-05
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 3e-05
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 3e-05
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 3e-05
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 4e-05
cd1177452 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain 4e-05
cd1196656 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA 4e-05
cd1190556 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty 4e-05
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 5e-05
cd1176854 cd11768, SH3_Tec_like, Src Homology 3 domain of Te 6e-05
cd1191255 cd11912, SH3_Bzz1_1, First Src Homology 3 domain o 6e-05
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 7e-05
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 8e-05
cd1180252 cd11802, SH3_Endophilin_B, Src homology 3 domain o 8e-05
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 1e-04
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 1e-04
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 1e-04
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 1e-04
cd1178859 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras 1e-04
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 1e-04
cd1182554 cd11825, SH3_PLCgamma, Src homology 3 domain of Ph 1e-04
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 1e-04
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 2e-04
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 2e-04
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 2e-04
cd1186458 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of 2e-04
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 3e-04
cd1205356 cd12053, SH3_CD2AP_1, First Src Homology 3 domain 3e-04
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 4e-04
cd1189558 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai 5e-04
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 5e-04
cd1199252 cd11992, SH3_Intersectin2_3, Third Src homology 3 5e-04
cd1198857 cd11988, SH3_Intersectin2_1, First Src homology 3 5e-04
cd1201753 cd12017, SH3_Tks_3, Third Src homology 3 domain of 6e-04
cd1185755 cd11857, SH3_DBS, Src homology 3 domain of DBL's B 6e-04
cd1201654 cd12016, SH3_Tks_2, Second Src homology 3 domain o 7e-04
cd1195553 cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl 7e-04
cd1183554 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of 7e-04
cd1191155 cd11911, SH3_CIP4-like, Src Homology 3 domain of C 8e-04
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 8e-04
cd1207453 cd12074, SH3_Tks5_1, First Src homology 3 domain o 8e-04
cd1196955 cd11969, SH3_PLCgamma2, Src homology 3 domain of P 0.001
cd1204553 cd12045, SH3_SKAP2, Src Homology 3 domain of Src K 0.001
cd1181552 cd11815, SH3_Eve1_2, Second Src homology 3 domain 0.001
cd1188854 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o 0.001
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 0.002
cd1190359 cd11903, SH3_Nck2_3, Third Src Homology 3 domain o 0.002
cd1175752 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 0.002
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 0.002
cd1181050 cd11810, SH3_RUSC1_like, Src homology 3 domain of 0.002
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 0.002
cd1201553 cd12015, SH3_Tks_1, First Src homology 3 domain of 0.002
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 0.002
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 0.002
cd1207654 cd12076, SH3_Tks4_2, Second Src homology 3 domain 0.002
cd1188555 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d 0.003
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 0.003
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 0.003
cd1190155 cd11901, SH3_Nck1_2, Second Src Homology 3 domain 0.003
cd1193155 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai 0.003
cd1207853 cd12078, SH3_Tks4_3, Third Src homology 3 domain o 0.003
cd1187154 cd11871, SH3_p67phox_N, N-terminal (or first) Src 0.004
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 0.004
cd1207754 cd12077, SH3_Tks5_2, Second Src homology 3 domain 0.004
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
 Score =  110 bits (277), Expect = 3e-33
 Identities = 41/57 (71%), Positives = 50/57 (87%)

Query: 70  GAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGL 126
           G VYAL+DYEA N DELSF+ G+ + VLRKGD++E EWWW++LN+KEGYVPRNLLGL
Sbjct: 1   GVVYALFDYEAENGDELSFREGDELTVLRKGDDDETEWWWARLNDKEGYVPRNLLGL 57


The ASPP family of proteins bind to important regulators of apoptosis (p53, Bcl-2, and RelA) and cell growth (APCL, PP1). They share similarity at their C-termini, where they harbor a proline-rich region, four ankyrin (ANK) repeats, and an SH3 domain. Vertebrates contain three members of the family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2 activate the apoptotic function of the p53 family of tumor suppressors (p53, p63, and p73), while iASPP is an oncoprotein that specifically inhibits p53-induced apoptosis. The expression of ASPP proteins is altered in tumors; ASPP1 and ASPP2 are downregulated whereas iASPP is upregulated is some cancer types. ASPP proteins also bind and regulate protein phosphatase 1 (PP1), and this binding is competitive with p53 binding. The SH3 domain and the ANK repeats of ASPP contribute to the p53 binding site; they bind to the DNA binding domain of p53. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 57

>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 Back     alignment and domain information
>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 Back     alignment and domain information
>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 Back     alignment and domain information
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate Back     alignment and domain information
>gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information
>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins Back     alignment and domain information
>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 Back     alignment and domain information
>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 Back     alignment and domain information
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor Back     alignment and domain information
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 Back     alignment and domain information
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 Back     alignment and domain information
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 Back     alignment and domain information
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins Back     alignment and domain information
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 Back     alignment and domain information
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 Back     alignment and domain information
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212874 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37 Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 Back     alignment and domain information
>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212791 cd11857, SH3_DBS, Src homology 3 domain of DBL's Big Sister (DBS), a guanine nucleotide exchange factor Back     alignment and domain information
>gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho GTPase-activating proteins 32 and 33, and similar proteins Back     alignment and domain information
>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains Back     alignment and domain information
>gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 Back     alignment and domain information
>gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 Back     alignment and domain information
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|213011 cd12078, SH3_Tks4_3, Third Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
KOG0515|consensus752 100.0
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.6
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.49
KOG2070|consensus 661 99.41
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.36
KOG2199|consensus 462 99.32
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.28
KOG1029|consensus1118 99.26
KOG1118|consensus366 99.26
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.24
KOG4225|consensus 489 99.2
KOG4226|consensus 379 99.15
KOG2996|consensus865 99.13
KOG2856|consensus472 99.12
KOG4226|consensus 379 99.08
KOG0162|consensus1106 99.08
KOG4348|consensus 627 99.04
KOG1029|consensus 1118 98.92
KOG4348|consensus 627 98.86
KOG1264|consensus 1267 98.81
KOG4225|consensus489 98.8
KOG4792|consensus 293 98.79
KOG2546|consensus483 98.74
KOG1843|consensus473 98.7
KOG3655|consensus484 98.61
KOG3875|consensus362 98.61
KOG1702|consensus264 98.44
KOG3601|consensus222 98.38
KOG4278|consensus 1157 98.34
KOG3632|consensus 1335 98.12
KOG3557|consensus 721 98.03
KOG2222|consensus 848 97.98
KOG3523|consensus695 97.98
KOG2528|consensus 490 97.97
KOG4773|consensus 386 97.7
KOG4792|consensus293 97.58
KOG0197|consensus 468 97.53
KOG3725|consensus375 97.43
KOG4575|consensus 874 97.43
KOG3771|consensus460 97.43
KOG1451|consensus812 97.41
KOG0609|consensus 542 97.39
KOG3601|consensus 222 97.16
KOG4429|consensus421 96.95
KOG3775|consensus 482 96.76
KOG3565|consensus640 96.39
PF1360630 Ank_3: Ankyrin repeat 96.36
KOG3632|consensus 1335 96.15
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 95.3
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 95.21
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 95.21
KOG0199|consensus 1039 94.97
PRK10884 206 SH3 domain-containing protein; Provisional 94.81
KOG0040|consensus 2399 93.81
smart0028763 SH3b Bacterial SH3 domain homologues. 93.43
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 93.29
KOG2996|consensus 865 91.36
KOG3812|consensus 475 90.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 89.77
KOG3705|consensus580 88.86
PRK13914 481 invasion associated secreted endopeptidase; Provis 87.96
COG3103 205 SH3 domain protein [Signal transduction mechanisms 85.17
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 83.26
KOG0505|consensus 527 82.5
>KOG0515|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-35  Score=238.74  Aligned_cols=129  Identities=52%  Similarity=0.973  Sum_probs=124.9

Q ss_pred             hhhhhcCCCchhhhhh-cccceecccccCChhhhhhhhccccCCcccccchhhhhHhhhcccCCcceEEeeccCCCCCCC
Q psy7685           7 QKIHFTCTTLAVCSLS-FVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDE   85 (137)
Q Consensus         7 ~~~~a~~~~~~~~~~l-~~g~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~dy~~~~~~e   85 (137)
                      .|||||||++++|++| ++|++|||+|.||.+|++++|++.+++|..|++|++.++++++.++.+.+.|+|||+++..||
T Consensus       620 LHCAASCNnv~~ckqLVe~GaavfAsTlSDmeTa~eKCee~eeGY~~CsqyL~~vqesmG~mN~G~vYAlwdYeaqf~DE  699 (752)
T KOG0515|consen  620 LHCAASCNNVPMCKQLVESGAAVFASTLSDMETAAEKCEEMEEGYDQCSQYLYGVQESMGSMNKGVVYALWDYEAQFEDE  699 (752)
T ss_pred             hhhhhhcCchHHHHHHHhccceEEeeecccccchhhhcchhhhhHHHHHHHHHHHHHhhcccccceeEEeeccccccccc
Confidence            5999999999999999 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCEEEEEEecCCCCCCeEEEEeCCeeEEEcCCCeeecCCCCCCCC
Q psy7685          86 LSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSAT  135 (137)
Q Consensus        86 Ls~~~Gd~i~vl~~~~~~~~gWw~g~~~g~~G~~P~~yv~~~~~~~~~~~  135 (137)
                      |+|+.||.++||+++++.+..||+++++|++|+||.||+..++..+|+..
T Consensus       700 Lsf~eGd~lTvirr~d~~eteWWwa~lng~eGyVPRnylgLyPriKprqr  749 (752)
T KOG0515|consen  700 LSFDEGDELTVIRRDDEVETEWWWARLNGEEGYVPRNYLGLYPRIKPRQR  749 (752)
T ss_pred             ccccCCceeEEEecCCcchhhhhhHhhcCcccccchhhhhcCccccchhh
Confidence            99999999999999888788899999999999999999999999988753



>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>COG3103 SH3 domain protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-32
1ycs_B239 P53-53bp2 Complex Length = 239 2e-32
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 4e-25
3gf9_A 295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 6e-08
2drk_A59 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 7e-08
2drm_A58 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 8e-08
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 3e-07
4gbq_A74 Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D 4e-07
1gri_A 217 Grb2 Length = 217 7e-07
3jv3_A 283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 2e-06
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 2e-06
2pz1_A 466 Crystal Structure Of Auto-Inhibited Asef Length = 4 4e-06
1wyx_A69 The Crystal Structure Of The P130cas Sh3 Domain At 4e-06
1ad5_A 438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 5e-06
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 5e-06
1oeb_A62 MonaGADS SH3C DOMAIN Length = 62 5e-06
2oi3_A86 Nmr Structure Analysis Of The Hematopoetic Cell Kin 6e-06
2d0n_A59 Crystal Structure Of The C-Terminal Sh3 Domain Of T 7e-06
2dx1_A 482 Crystal Structure Of Rhogef Protein Asef Length = 4 7e-06
4hck_A72 Human Hck Sh3 Domain, Nmr, 25 Structures Length = 7 7e-06
1uti_A58 MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L 7e-06
3nhn_A 193 Crystal Structure Of The Src-Family Kinase Hck Sh3- 7e-06
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 7e-06
1h3h_A60 Structural Basis For Specific Recognition Of An Rxx 7e-06
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 7e-06
1bu1_A57 Src Family Kinase Hck Sh3 Domain Length = 57 7e-06
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 7e-06
1aze_A56 Nmr Structure Of The Complex Between The C32s-Y7v M 8e-06
3nmz_D116 Crytal Structure Of Apc Complexed With Asef Length 1e-05
4esr_A69 Molecular And Structural Characterization Of The Sh 1e-05
2dl7_A73 Solution Structure Of The Second Sh3 Domain Of Huma 1e-05
1wa7_A65 Sh3 Domain Of Human Lyn Tyrosine Kinase Length = 65 2e-05
2yt6_A109 Solution Structure Of The Sh3_1 Domain Of Yamaguchi 2e-05
1oot_A60 Crystal Structure Of The Sh3 Domain From A S. Cerev 2e-05
2xmf_A60 Myosin 1e Sh3 Length = 60 2e-05
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 2e-05
2jte_A64 Third Sh3 Domain Of Cd2ap Length = 64 3e-05
2ysq_A81 Solution Structure Of The Sh3 Domain From Rho Guani 3e-05
2hda_A64 Yes Sh3 Domain Length = 64 3e-05
3reb_B90 Hiv-1 Nef Protein In Complex With Engineered Hck-Sh 3e-05
2kgt_A72 Solution Structure Of Sh3 Domain Of Ptk6 Length = 7 4e-05
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 4e-05
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 4e-05
2x3w_D60 Structure Of Mouse Syndapin I (Crystal Form 2) Leng 4e-05
3rea_B61 Hiv-1 Nef Protein In Complex With Engineered Hck-Sh 5e-05
2dil_A69 Solution Structure Of The Sh3 Domain Of The Human P 5e-05
2ydl_A69 Crystal Structure Of Sh3c From Cin85 Length = 69 5e-05
1x2p_A68 Solution Structure Of The Sh3 Domain Of The Protein 6e-05
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 7e-05
3haj_A486 Crystal Structure Of Human Pacsin2 F-Bar Domain (P2 7e-05
3m0p_A62 Crystal Structure Of The R21d Mutant Of Alpha-Spect 7e-05
3m0s_A57 Crystal Structure Of The R21d Mutant Of Alpha-Spect 7e-05
2k2m_A68 Structural Basis Of Pxxdy Motif Recognition In Sh3 7e-05
2k6d_A62 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 8e-05
2k9g_A73 Solution Structure Of The Third Sh3 Domain Of The C 9e-05
2d8h_A80 Solution Structure Of The Sh3 Domain Of Hypothetica 9e-05
1a0n_B69 Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene 1e-04
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 1e-04
1azg_B67 Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene 1e-04
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 1e-04
3uf4_A164 Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P 1e-04
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 2e-04
1uhc_A79 Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of 2e-04
2vvk_A56 Grb2 Sh3c (1) Length = 56 2e-04
3ua6_A64 Crystal Structure Of The Human Fyn Sh3 Domain Lengt 2e-04
2a37_A59 Solution Structure Of The T22g Mutant Of N-Terminal 2e-04
1hd3_A62 A-Spectrin Sh3 Domain F52y Mutant Length = 62 2e-04
1fyn_A62 Phosphotransferase Length = 62 2e-04
2bz8_A58 N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti 3e-04
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 3e-04
1m27_C61 Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX 3e-04
2rol_A64 Structural Basis Of Pxxdy Motif Recognition In Sh3 3e-04
1avz_C57 V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D 3e-04
3thk_A73 Structure Of Sh3 Chimera With A Type Ii Ligand Link 3e-04
1shf_A59 Crystal Structure Of The Sh3 Domain In Human Fyn; C 3e-04
3h0h_A73 Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le 3e-04
1uue_A62 A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 3e-04
2da9_A70 Solution Structure Of The Third Sh3 Domain Of Sh3-D 3e-04
2krn_A60 High Resolution Structure Of The Second Sh3 Domain 4e-04
2ed1_A76 Solution Structure Of The Sh3 Domain Of 130 Kda Pho 4e-04
2ed0_A78 Solution Structure Of The Sh3 Domain Of Abl Interac 4e-04
1pwt_A61 Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw 4e-04
1neg_A83 Crystal Structure Analysis Of N-And C-Terminal Labe 4e-04
2f2x_A62 Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 5e-04
3i9q_A57 Crystal Structure Of The Triple Mutant S19g-P20d-R2 5e-04
2lj3_A63 Pfbd: High-Throughput Strategy Of Backbone Fold Det 5e-04
1m8m_A62 Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 5e-04
2cdt_A62 Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 6e-04
2f2v_A62 Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 6e-04
2f2w_A62 Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 6e-04
1efn_A59 Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S 6e-04
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 7e-04
3h0f_A73 Crystal Structure Of The Human Fyn Sh3 R96w Mutant 7e-04
1wxb_A68 Solution Structure Of The Sh3 Domain From Human Epi 7e-04
1bk2_A57 A-Spectrin Sh3 Domain D48g Mutant Length = 57 7e-04
3rbb_B61 Hiv-1 Nef Protein In Complex With Engineered Hck Sh 8e-04
3cqt_A79 N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 8e-04
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure

Iteration: 1

Score = 134 bits (336), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 1/122 (0%) Query: 12 TCTTLAVCS-LSFVLYCIFATTHSDHETAAVKXXXXXXXXXXXXXXLYSVQEKLGILNNG 70 +C + VC L +FA T+SD +TAA K LY VQEK+GI+N G Sbjct: 112 SCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKG 171 Query: 71 AVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRV 130 +YAL+DYE N DEL K G+C+ ++ + DE+E EWWW++LN+KEGYVPRNLLGLYPR+ Sbjct: 172 VIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI 231 Query: 131 QP 132 +P Sbjct: 232 KP 233
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 Back     alignment and structure
>pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 Back     alignment and structure
>pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 Back     alignment and structure
>pdb|2OI3|A Chain A, Nmr Structure Analysis Of The Hematopoetic Cell Kinase Sh3 Domain Complexed With An Artificial High Affinity Ligand (Pd1) Length = 86 Back     alignment and structure
>pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 Back     alignment and structure
>pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 Back     alignment and structure
>pdb|4HCK|A Chain A, Human Hck Sh3 Domain, Nmr, 25 Structures Length = 72 Back     alignment and structure
>pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 Back     alignment and structure
>pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1BU1|A Chain A, Src Family Kinase Hck Sh3 Domain Length = 57 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 Back     alignment and structure
>pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 Back     alignment and structure
>pdb|4ESR|A Chain A, Molecular And Structural Characterization Of The Sh3 Domain Of Ahi-1 In Regulation Of Cellular Resistance Of Bcr-Abl+ Chronic Myeloid Leukemia Cells To Tyrosine Kinase Inhibitors Length = 69 Back     alignment and structure
>pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 Back     alignment and structure
>pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 Back     alignment and structure
>pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 Back     alignment and structure
>pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|2JTE|A Chain A, Third Sh3 Domain Of Cd2ap Length = 64 Back     alignment and structure
>pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 Back     alignment and structure
>pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 Back     alignment and structure
>pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 Back     alignment and structure
>pdb|2KGT|A Chain A, Solution Structure Of Sh3 Domain Of Ptk6 Length = 72 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 Back     alignment and structure
>pdb|3REA|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 61 Back     alignment and structure
>pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 Back     alignment and structure
>pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 Back     alignment and structure
>pdb|1X2P|A Chain A, Solution Structure Of The Sh3 Domain Of The Protein Arginine N-Methyltransferase 2 Length = 68 Back     alignment and structure
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) Length = 486 Back     alignment and structure
>pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 Back     alignment and structure
>pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 Back     alignment and structure
>pdb|2K2M|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 68 Back     alignment and structure
>pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 Back     alignment and structure
>pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 Back     alignment and structure
>pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 Back     alignment and structure
>pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|1UHC|A Chain A, Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of Kiaa1010 Protein [homo Sapiens] Length = 79 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 Back     alignment and structure
>pdb|2A37|A Chain A, Solution Structure Of The T22g Mutant Of N-Terminal Sh3 Domain Of Drk (Drkn Sh3 Domain) Length = 59 Back     alignment and structure
>pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 Back     alignment and structure
>pdb|1FYN|A Chain A, Phosphotransferase Length = 62 Back     alignment and structure
>pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 Back     alignment and structure
>pdb|2ROL|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 64 Back     alignment and structure
>pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 Back     alignment and structure
>pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 Back     alignment and structure
>pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 Back     alignment and structure
>pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 Back     alignment and structure
>pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 Back     alignment and structure
>pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 Back     alignment and structure
>pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 Back     alignment and structure
>pdb|2ED1|A Chain A, Solution Structure Of The Sh3 Domain Of 130 Kda Phosphatidylinositol 4,5-Biphosphate-Dependent Arf1 Gtpase- Activating Protein Length = 76 Back     alignment and structure
>pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 Back     alignment and structure
>pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 Back     alignment and structure
>pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 Back     alignment and structure
>pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 Back     alignment and structure
>pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 Back     alignment and structure
>pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 Back     alignment and structure
>pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 Back     alignment and structure
>pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 Back     alignment and structure
>pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 Back     alignment and structure
>pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 Back     alignment and structure
>pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 Back     alignment and structure
>pdb|1WXB|A Chain A, Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein Length = 68 Back     alignment and structure
>pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 Back     alignment and structure
>pdb|3RBB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck Sh3 Domain Length = 61 Back     alignment and structure
>pdb|3CQT|A Chain A, N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-36
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-28
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-23
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 4e-23
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 1e-19
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 8e-19
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 9e-19
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 1e-18
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 2e-18
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 2e-18
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 2e-18
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 4e-18
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 4e-18
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 6e-18
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 8e-18
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 9e-18
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 1e-17
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-17
1wxb_A68 Epidermal growth factor receptor pathway substrate 1e-17
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 1e-17
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 1e-17
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 2e-17
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-17
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 2e-17
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 3e-17
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 4e-17
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 4e-17
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-17
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 5e-17
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 5e-17
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 6e-17
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 6e-17
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 7e-17
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 8e-17
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 9e-17
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 9e-17
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 1e-16
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 1e-16
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 1e-16
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 1e-16
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 1e-16
1uti_A58 GRB2-related adaptor protein 2; signaling protein 1e-16
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 1e-16
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 2e-16
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 2e-16
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 2e-16
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 2e-16
2dil_A69 Proline-serine-threonine phosphatase-interacting p 2e-16
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-16
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-16
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 3e-16
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 3e-16
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 3e-16
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 3e-16
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 3e-16
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 3e-16
1awj_A77 ITK; transferase, regulatory intramolecular comple 4e-16
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 4e-16
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 4e-16
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 4e-16
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 5e-16
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 6e-16
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 6e-16
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 6e-16
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 7e-16
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 8e-16
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 9e-16
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 1e-15
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 1e-15
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 1e-15
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 1e-15
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-15
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 1e-15
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 1e-15
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 1e-15
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 1e-15
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 1e-15
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 2e-15
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-15
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-15
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 2e-15
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-15
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 2e-15
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 3e-15
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 3e-15
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 3e-15
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 3e-15
1i07_A60 Epidermal growth factor receptor kinase substrate 3e-15
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 3e-15
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 3e-15
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 3e-15
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 3e-15
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 3e-15
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 4e-15
3u23_A65 CD2-associated protein; structural genomics, struc 4e-15
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 5e-15
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 5e-15
1ng2_A 193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 5e-15
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 9e-15
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 5e-15
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 6e-15
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 6e-15
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 6e-15
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 7e-15
2j6f_A62 CD2-associated protein; metal-binding, immune resp 7e-15
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 7e-15
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 8e-15
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 8e-15
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 8e-15
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 8e-15
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 8e-15
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 9e-15
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-14
2da9_A70 SH3-domain kinase binding protein 1; structural ge 1e-14
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-14
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 1e-14
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 1e-14
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 1e-14
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-14
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 2e-14
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-14
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 2e-14
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 3e-14
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 4e-14
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 7e-14
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 7e-14
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 8e-14
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 9e-14
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 1e-13
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-13
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 7e-12
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 2e-13
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 2e-13
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 2e-13
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 2e-13
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 2e-13
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 4e-13
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 4e-13
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 5e-13
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 6e-13
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 8e-13
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 9e-13
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 1e-12
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-12
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 1e-12
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 2e-12
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 2e-12
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 2e-12
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-12
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-12
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-12
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 3e-12
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 3e-12
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-12
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 4e-12
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 4e-12
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 5e-12
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 5e-12
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 8e-08
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 5e-12
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 5e-12
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 1e-11
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-11
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 2e-11
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 2e-11
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-11
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 4e-11
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 4e-11
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 7e-11
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-10
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 2e-10
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-10
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-07
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-10
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 3e-10
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 3e-10
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-10
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-10
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 4e-10
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 6e-10
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 9e-10
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 8e-08
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 1e-09
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 1e-09
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 2e-09
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 4e-09
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 7e-09
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 2e-08
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-08
1u3o_A82 Huntingtin-associated protein-interacting protein; 5e-08
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 3e-07
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 6e-07
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 2e-06
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 4e-05
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 4e-05
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 7e-05
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 9e-05
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
 Score =  123 bits (312), Expect = 2e-36
 Identities = 66/110 (60%), Positives = 86/110 (78%)

Query: 27  CIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDEL 86
            +FA T+SD +TAA KCEE EEG+  CS+FLY VQEK+GI+N G +YAL+DYE  N DEL
Sbjct: 128 AVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDEL 187

Query: 87  SFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATP 136
             K G+C+ ++ + DE+E EWWW++LN+KEGYVPRNLLGLYPR++P    
Sbjct: 188 PMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRS 237


>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Length = 96 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.75
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.71
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.7
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.7
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.69
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.68
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.67
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.67
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.67
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.67
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.66
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.66
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.66
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.66
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.66
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.66
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.66
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.65
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.65
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.65
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.65
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.65
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.65
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.65
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.65
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.64
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.64
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.64
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.64
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.64
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.64
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.64
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.64
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.64
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.64
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.64
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.64
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.64
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.64
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.63
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.63
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.63
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.63
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.63
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.63
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.63
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.63
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.63
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.63
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.63
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.63
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.63
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.63
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.63
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.63
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.63
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.63
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.63
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.63
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.63
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.63
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.63
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.62
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.62
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.62
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.62
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.62
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.62
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.62
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.62
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.62
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.62
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.62
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.62
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.62
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.62
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.62
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.61
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.61
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.61
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.61
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.61
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.61
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.61
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.61
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.61
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.61
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.61
3u23_A65 CD2-associated protein; structural genomics, struc 99.61
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.61
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.61
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.6
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.6
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.6
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.6
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.6
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.6
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.6
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.6
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.6
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.6
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.6
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.6
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.6
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.6
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.6
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.6
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.59
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.59
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.59
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.59
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.59
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.59
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.59
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.59
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.59
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.59
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.59
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.59
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.58
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.58
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.58
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.58
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.58
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.58
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.58
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.58
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.58
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.58
1i07_A60 Epidermal growth factor receptor kinase substrate 99.58
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.58
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.58
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.58
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.57
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.57
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.57
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.57
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.57
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.57
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.57
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.57
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.56
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.56
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.56
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.55
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.55
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.55
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.54
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.54
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.54
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.54
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.53
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.53
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.53
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.52
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.52
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.51
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.51
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.5
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.49
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.48
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.48
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.47
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.46
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.46
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.45
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.44
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.42
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.4
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.39
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.38
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.38
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.37
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.37
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.36
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.34
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.34
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.33
1ng2_A 193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.33
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.31
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.31
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.3
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.28
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.28
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.28
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 99.25
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.22
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.2
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 99.19
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.18
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.18
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.17
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.17
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.79
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.7
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 99.11
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.1
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.08
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.0
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 99.0
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.95
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.94
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.88
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.85
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.76
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.58
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.56
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.42
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.42
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.38
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.36
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.22
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 98.18
3r6n_A 450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.81
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.68
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 96.67
2kt8_A76 Probable surface protein; SH3 family, structural g 96.57
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 95.99
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 93.24
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 92.72
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 90.31
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 83.34
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=1.4e-18  Score=103.88  Aligned_cols=57  Identities=25%  Similarity=0.568  Sum_probs=50.2

Q ss_pred             CCcceEEeeccCCCCCCC-CCCCCCCEEEEEEecCCCCCCeEEEE-eCCeeEEEcCCCeeec
Q psy7685          68 NNGAVYALYDYEANNTDE-LSFKTGECIIVLRKGDENEREWWWSK-LNNKEGYVPRNLLGLY  127 (137)
Q Consensus        68 ~~~~~~al~dy~~~~~~e-Ls~~~Gd~i~vl~~~~~~~~gWw~g~-~~g~~G~~P~~yv~~~  127 (137)
                      .+.+++|+|||.++.++| |+|++||+|.|+++.++   |||.|+ .+|++|+||+|||+.+
T Consensus         2 sg~~~rAlydy~~~~~~e~Ls~~~Gd~i~v~~~~~~---~Ww~g~~~~G~~G~fP~nyVe~i   60 (60)
T 2lx7_A            2 SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDG---GWWEGEKEDGLRGWFPASYVQLL   60 (60)
T ss_dssp             CSCEEEESCCCCSCCCSSCCCCCTTCEEEBSCCCTT---SCEEEECTTSCEEEECGGGEEEC
T ss_pred             CCCEEEECcccCCCCCCCCccCCCCCEEEEeEecCC---CeEEEEeCCCCEEEEcHHHEEEC
Confidence            457899999999998887 99999999999987643   599999 5789999999999975



>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 137
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 3e-27
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 1e-17
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 4e-17
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 7e-17
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-16
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-16
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 2e-16
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 2e-16
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 3e-16
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-16
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 6e-16
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 6e-16
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 8e-16
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 1e-15
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-15
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 3e-15
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 4e-15
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 4e-15
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 4e-15
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 1e-14
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 1e-14
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 2e-14
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 2e-14
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 3e-14
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 4e-14
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-14
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 4e-14
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 4e-14
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 6e-14
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 8e-14
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 2e-13
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 2e-13
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 3e-13
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-12
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 2e-12
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 3e-12
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 6e-12
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 2e-11
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 3e-11
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 3e-11
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 4e-11
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 4e-11
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 6e-10
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 2e-09
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 7e-09
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 4e-08
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 4e-08
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 9e-07
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-04
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.1 bits (234), Expect = 3e-27
 Identities = 39/63 (61%), Positives = 51/63 (80%)

Query: 66  ILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLG 125
           I+N G +YAL+DYE  N DEL  K G+C+ ++ + DE+E EWWW++LN+KEGYVPRNLLG
Sbjct: 1   IMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLG 60

Query: 126 LYP 128
           LYP
Sbjct: 61  LYP 63


>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.72
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.72
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.72
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.71
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.7
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.7
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.69
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.69
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.68
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.68
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.68
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.67
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.67
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.67
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.67
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.66
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.66
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.66
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.66
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.66
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.66
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.66
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.66
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.66
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.65
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.64
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.64
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.64
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.63
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.63
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.62
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.62
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.61
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.61
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.61
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.58
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.58
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.55
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.55
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.55
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.54
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.47
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.45
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.27
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.03
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 96.1
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 89.54
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 84.12
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 81.73
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=8e-20  Score=108.94  Aligned_cols=62  Identities=61%  Similarity=1.349  Sum_probs=55.6

Q ss_pred             cCCcceEEeeccCCCCCCCCCCCCCCEEEEEEecCCCCCCeEEEEeCCeeEEEcCCCeeecC
Q psy7685          67 LNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYP  128 (137)
Q Consensus        67 ~~~~~~~al~dy~~~~~~eLs~~~Gd~i~vl~~~~~~~~gWw~g~~~g~~G~~P~~yv~~~~  128 (137)
                      ++.+.++|+|||.++.++||+|++||+|.|+++.+++..|||.|+.+|++|+||++||+.+|
T Consensus         2 ~n~g~v~Alydy~a~~~~ELs~~~Gd~i~vl~~~~~~~~gW~~g~~~g~~G~~P~~yv~~~P   63 (63)
T d1ycsb2           2 MNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP   63 (63)
T ss_dssp             TGGGEEEESSCBCCSSTTBCCBCSSCEEEECCCCTTSCSSEEEEEETTEEEEEEGGGEECCC
T ss_pred             CcCCEEEEeeCCCCCCCCCcCCCCCCEEEEEEecCCCCCCEEEEEECCeEEEEchHHhEeCc
Confidence            35567999999999999999999999999998866556689999999999999999999875



>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure