Psyllid ID: psy7685
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| 307177764 | 1216 | Apoptosis-stimulating of p53 protein 1 [ | 0.795 | 0.089 | 0.798 | 1e-49 | |
| 332018007 | 1074 | Apoptosis-stimulating of p53 protein 1 [ | 0.781 | 0.099 | 0.813 | 3e-49 | |
| 307214808 | 1075 | Apoptosis-stimulating of p53 protein 2 [ | 0.781 | 0.099 | 0.813 | 2e-48 | |
| 328785901 | 1329 | PREDICTED: hypothetical protein LOC41022 | 0.781 | 0.080 | 0.794 | 7e-48 | |
| 380029713 | 1308 | PREDICTED: uncharacterized protein LOC10 | 0.781 | 0.081 | 0.794 | 7e-48 | |
| 350400919 | 1292 | PREDICTED: hypothetical protein LOC10074 | 0.781 | 0.082 | 0.794 | 1e-47 | |
| 340719671 | 1289 | PREDICTED: hypothetical protein LOC10064 | 0.781 | 0.083 | 0.794 | 1e-47 | |
| 383862741 | 1287 | PREDICTED: uncharacterized protein LOC10 | 0.781 | 0.083 | 0.794 | 1e-47 | |
| 328722181 | 1041 | PREDICTED: hypothetical protein LOC10016 | 0.759 | 0.099 | 0.778 | 5e-46 | |
| 270005081 | 891 | hypothetical protein TcasGA2_TC007089 [T | 0.781 | 0.120 | 0.794 | 1e-45 |
| >gi|307177764|gb|EFN66761.1| Apoptosis-stimulating of p53 protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 200 bits (509), Expect = 1e-49, Method: Compositional matrix adjust.
Identities = 87/109 (79%), Positives = 99/109 (90%)
Query: 27 CIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDEL 86
CIFATT SDHETAA KCEEDEEGF+GCSE+LYSVQEKLGI+NNG VYA++DYEA + DEL
Sbjct: 1106 CIFATTLSDHETAAEKCEEDEEGFDGCSEYLYSVQEKLGIMNNGQVYAVFDYEAQHADEL 1165
Query: 87 SFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSAT 135
S K G+ ++VLRKGD+NEREWWWSKL +KEGYVPRNLLGLYPRVQP+ T
Sbjct: 1166 SLKNGDSVVVLRKGDDNEREWWWSKLGHKEGYVPRNLLGLYPRVQPAKT 1214
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332018007|gb|EGI58636.1| Apoptosis-stimulating of p53 protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307214808|gb|EFN89695.1| Apoptosis-stimulating of p53 protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328785901|ref|XP_393703.4| PREDICTED: hypothetical protein LOC410220 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380029713|ref|XP_003698511.1| PREDICTED: uncharacterized protein LOC100870125 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350400919|ref|XP_003486003.1| PREDICTED: hypothetical protein LOC100743731 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340719671|ref|XP_003398271.1| PREDICTED: hypothetical protein LOC100646232 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383862741|ref|XP_003706842.1| PREDICTED: uncharacterized protein LOC100877563 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328722181|ref|XP_001946955.2| PREDICTED: hypothetical protein LOC100161456 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|270005081|gb|EFA01529.1| hypothetical protein TcasGA2_TC007089 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| UNIPROTKB|F1NWV9 | 1094 | PPP1R13B "Uncharacterized prot | 0.883 | 0.110 | 0.540 | 2.3e-30 | |
| UNIPROTKB|F1P2P1 | 1101 | TP53BP2 "Uncharacterized prote | 0.883 | 0.109 | 0.516 | 3.9e-30 | |
| UNIPROTKB|B7Z2E9 | 367 | TP53BP2 "cDNA FLJ50500, highly | 0.883 | 0.329 | 0.491 | 4.9e-30 | |
| MGI|MGI:1336199 | 1087 | Ppp1r13b "protein phosphatase | 0.883 | 0.111 | 0.532 | 2.1e-29 | |
| RGD|1304651 | 967 | Ppp1r13b "protein phosphatase | 0.883 | 0.125 | 0.532 | 2.8e-29 | |
| UNIPROTKB|D4A6A8 | 1042 | Ppp1r13b "Protein Ppp1r13b" [R | 0.883 | 0.116 | 0.532 | 3.2e-29 | |
| UNIPROTKB|F1S642 | 1135 | TP53BP2 "Uncharacterized prote | 0.883 | 0.106 | 0.5 | 3.7e-29 | |
| UNIPROTKB|F1P985 | 1124 | TP53BP2 "Uncharacterized prote | 0.883 | 0.107 | 0.5 | 4.7e-29 | |
| UNIPROTKB|F1MWG7 | 1134 | TP53BP2 "Uncharacterized prote | 0.883 | 0.106 | 0.5 | 4.8e-29 | |
| UNIPROTKB|Q13625 | 1128 | TP53BP2 "Apoptosis-stimulating | 0.883 | 0.107 | 0.491 | 9.9e-29 |
| UNIPROTKB|F1NWV9 PPP1R13B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 347 (127.2 bits), Expect = 2.3e-30, P = 2.3e-30
Identities = 66/122 (54%), Positives = 84/122 (68%)
Query: 12 TCTTLAVCSLSFVL-YCIFATTHSDHETAAVKXXXXXXXXXXXXXXLYSVQEKLGILNNG 70
+C ++ +C L IFA+T SD ETAA K LY VQEKLG++N G
Sbjct: 967 SCNSVHLCKLLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKG 1026
Query: 71 AVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRV 130
VYAL+DYEA N DELSF G+ I +LR+ D+NE EWWW++LN+KEGYVP+NLLGLYPR+
Sbjct: 1027 VVYALWDYEAQNNDELSFHEGDAITILRRKDDNETEWWWARLNDKEGYVPKNLLGLYPRI 1086
Query: 131 QP 132
+P
Sbjct: 1087 KP 1088
|
|
| UNIPROTKB|F1P2P1 TP53BP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z2E9 TP53BP2 "cDNA FLJ50500, highly similar to Apoptosis-stimulating of p53 protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336199 Ppp1r13b "protein phosphatase 1, regulatory (inhibitor) subunit 13B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1304651 Ppp1r13b "protein phosphatase 1, regulatory subunit 13B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A6A8 Ppp1r13b "Protein Ppp1r13b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S642 TP53BP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P985 TP53BP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MWG7 TP53BP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13625 TP53BP2 "Apoptosis-stimulating of p53 protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 137 | |||
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 3e-33 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 4e-27 | |
| cd11953 | 57 | cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of | 3e-26 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 4e-19 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 3e-15 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 7e-14 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 3e-13 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 1e-12 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 2e-11 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 2e-11 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 7e-11 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 8e-11 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 1e-10 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 1e-10 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 3e-10 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 3e-10 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 4e-10 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 4e-10 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 7e-10 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 1e-09 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 1e-09 | |
| cd11821 | 53 | cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP | 2e-09 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 3e-09 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 3e-09 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 3e-09 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 4e-09 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 6e-09 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 6e-09 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 7e-09 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 1e-08 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 1e-08 | |
| cd12024 | 53 | cd12024, SH3_NoxO1_2, Second or C-terminal Src hom | 1e-08 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 1e-08 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 2e-08 | |
| cd12003 | 62 | cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr | 2e-08 | |
| cd12141 | 57 | cd12141, SH3_DNMBP_C2, Second C-terminal Src homol | 2e-08 | |
| cd11876 | 58 | cd11876, SH3_MLK, Src Homology 3 domain of Mixed L | 2e-08 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 2e-08 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 2e-08 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 3e-08 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 5e-08 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 5e-08 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 5e-08 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 6e-08 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 6e-08 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 7e-08 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 8e-08 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 9e-08 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 1e-07 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 1e-07 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 1e-07 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 2e-07 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 2e-07 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 2e-07 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 2e-07 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 2e-07 | |
| cd11847 | 58 | cd11847, SH3_Brk, Src homology 3 domain of Brk (Br | 2e-07 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 2e-07 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 2e-07 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 2e-07 | |
| cd11761 | 57 | cd11761, SH3_FCHSD_1, First Src Homology 3 domain | 2e-07 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 3e-07 | |
| cd11973 | 73 | cd11973, SH3_ASEF, Src homology 3 domain of APC-St | 4e-07 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 4e-07 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 4e-07 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 5e-07 | |
| cd11878 | 54 | cd11878, SH3_Bem1p_1, First Src Homology 3 domain | 6e-07 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 7e-07 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 8e-07 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 8e-07 | |
| cd12000 | 57 | cd12000, SH3_CASS4, Src homology 3 domain of CAS ( | 8e-07 | |
| cd11998 | 56 | cd11998, SH3_PACSIN1-2, Src homology 3 domain of P | 1e-06 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 1e-06 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 2e-06 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 2e-06 | |
| cd11974 | 54 | cd11974, SH3_ASEF2, Src homology 3 domain of APC-S | 2e-06 | |
| cd12013 | 61 | cd12013, SH3_RIM-BP_3, Third Src homology 3 domain | 2e-06 | |
| cd11894 | 56 | cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai | 2e-06 | |
| cd12012 | 62 | cd12012, SH3_RIM-BP_2, Second Src homology 3 domai | 2e-06 | |
| cd11904 | 57 | cd11904, SH3_Nck1_3, Third Src Homology 3 domain o | 2e-06 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 2e-06 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 2e-06 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 3e-06 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 3e-06 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 4e-06 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 4e-06 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 4e-06 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 4e-06 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 4e-06 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 5e-06 | |
| cd12005 | 54 | cd12005, SH3_Lck, Src homology 3 domain of Lck Pro | 5e-06 | |
| cd12002 | 57 | cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( | 5e-06 | |
| cd11787 | 53 | cd11787, SH3_SH3RF_2, Second Src Homology 3 domain | 5e-06 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 5e-06 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 6e-06 | |
| cd12052 | 53 | cd12052, SH3_CIN85_1, First Src Homology 3 domain | 7e-06 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 7e-06 | |
| cd11997 | 56 | cd11997, SH3_PACSIN3, Src homology 3 domain of Pro | 8e-06 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 1e-05 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 1e-05 | |
| cd11991 | 52 | cd11991, SH3_Intersectin1_3, Third Src homology 3 | 1e-05 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 1e-05 | |
| cd11941 | 57 | cd11941, SH3_ARHGEF37_C2, Second C-terminal Src ho | 1e-05 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 1e-05 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 1e-05 | |
| cd11790 | 64 | cd11790, SH3_Amphiphysin, Src Homology 3 domain of | 2e-05 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 2e-05 | |
| cd11965 | 57 | cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA | 2e-05 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 2e-05 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 2e-05 | |
| cd12008 | 56 | cd12008, SH3_Src, Src homology 3 domain of Src Pro | 2e-05 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 2e-05 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 2e-05 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 2e-05 | |
| cd12044 | 53 | cd12044, SH3_SKAP1, Src Homology 3 domain of Src K | 3e-05 | |
| cd12021 | 53 | cd12021, SH3_p47phox_1, First or N-terminal Src ho | 3e-05 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 3e-05 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 3e-05 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 3e-05 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 3e-05 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 4e-05 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 4e-05 | |
| cd11966 | 56 | cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA | 4e-05 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 4e-05 | |
| cd11933 | 58 | cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 | 5e-05 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 6e-05 | |
| cd11912 | 55 | cd11912, SH3_Bzz1_1, First Src Homology 3 domain o | 6e-05 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 7e-05 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 8e-05 | |
| cd11802 | 52 | cd11802, SH3_Endophilin_B, Src homology 3 domain o | 8e-05 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 1e-04 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 1e-04 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 1e-04 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 1e-04 | |
| cd11788 | 59 | cd11788, SH3_RasGAP, Src Homology 3 domain of Ras | 1e-04 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 1e-04 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 1e-04 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 1e-04 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 2e-04 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 2e-04 | |
| cd11884 | 56 | cd11884, SH3_MYO15, Src Homology 3 domain of Myosi | 2e-04 | |
| cd11864 | 58 | cd11864, SH3_PEX13_eumet, Src Homology 3 domain of | 2e-04 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 3e-04 | |
| cd12053 | 56 | cd12053, SH3_CD2AP_1, First Src Homology 3 domain | 3e-04 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 4e-04 | |
| cd11895 | 58 | cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai | 5e-04 | |
| cd12055 | 53 | cd12055, SH3_CIN85_2, Second Src Homology 3 domain | 5e-04 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 5e-04 | |
| cd11988 | 57 | cd11988, SH3_Intersectin2_1, First Src homology 3 | 5e-04 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 6e-04 | |
| cd11857 | 55 | cd11857, SH3_DBS, Src homology 3 domain of DBL's B | 6e-04 | |
| cd12016 | 54 | cd12016, SH3_Tks_2, Second Src homology 3 domain o | 7e-04 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 7e-04 | |
| cd11835 | 54 | cd11835, SH3_ARHGAP32_33, Src homology 3 domain of | 7e-04 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 8e-04 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 8e-04 | |
| cd12074 | 53 | cd12074, SH3_Tks5_1, First Src homology 3 domain o | 8e-04 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 0.001 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 0.001 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 0.001 | |
| cd11888 | 54 | cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o | 0.001 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 0.002 | |
| cd11903 | 59 | cd11903, SH3_Nck2_3, Third Src Homology 3 domain o | 0.002 | |
| cd11757 | 52 | cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 | 0.002 | |
| cd11869 | 54 | cd11869, SH3_p40phox, Src Homology 3 domain of the | 0.002 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 0.002 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 0.002 | |
| cd12015 | 53 | cd12015, SH3_Tks_1, First Src homology 3 domain of | 0.002 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 0.002 | |
| cd11935 | 58 | cd11935, SH3_Nebulette_C, C-terminal Src Homology | 0.002 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 0.002 | |
| cd11885 | 55 | cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d | 0.003 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 0.003 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 0.003 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 0.003 | |
| cd11931 | 55 | cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai | 0.003 | |
| cd12078 | 53 | cd12078, SH3_Tks4_3, Third Src homology 3 domain o | 0.003 | |
| cd11871 | 54 | cd11871, SH3_p67phox_N, N-terminal (or first) Src | 0.004 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 0.004 | |
| cd12077 | 54 | cd12077, SH3_Tks5_2, Second Src homology 3 domain | 0.004 |
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
Score = 110 bits (277), Expect = 3e-33
Identities = 41/57 (71%), Positives = 50/57 (87%)
Query: 70 GAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGL 126
G VYAL+DYEA N DELSF+ G+ + VLRKGD++E EWWW++LN+KEGYVPRNLLGL
Sbjct: 1 GVVYALFDYEAENGDELSFREGDELTVLRKGDDDETEWWWARLNDKEGYVPRNLLGL 57
|
The ASPP family of proteins bind to important regulators of apoptosis (p53, Bcl-2, and RelA) and cell growth (APCL, PP1). They share similarity at their C-termini, where they harbor a proline-rich region, four ankyrin (ANK) repeats, and an SH3 domain. Vertebrates contain three members of the family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2 activate the apoptotic function of the p53 family of tumor suppressors (p53, p63, and p73), while iASPP is an oncoprotein that specifically inhibits p53-induced apoptosis. The expression of ASPP proteins is altered in tumors; ASPP1 and ASPP2 are downregulated whereas iASPP is upregulated is some cancer types. ASPP proteins also bind and regulate protein phosphatase 1 (PP1), and this binding is competitive with p53 binding. The SH3 domain and the ANK repeats of ASPP contribute to the p53 binding site; they bind to the DNA binding domain of p53. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 57 |
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate | Back alignment and domain information |
|---|
| >gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud emergence protein 1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 | Back alignment and domain information |
|---|
| >gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212874 cd11941, SH3_ARHGEF37_C2, Second C-terminal Src homology 3 domain of Rho guanine nucleotide exchange factor 37 | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV | Back alignment and domain information |
|---|
| >gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212791 cd11857, SH3_DBS, Src homology 3 domain of DBL's Big Sister (DBS), a guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho GTPase-activating proteins 32 and 33, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|213011 cd12078, SH3_Tks4_3, Third Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| KOG0515|consensus | 752 | 100.0 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.6 | |
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.49 | |
| KOG2070|consensus | 661 | 99.41 | ||
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.36 | |
| KOG2199|consensus | 462 | 99.32 | ||
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 99.28 | |
| KOG1029|consensus | 1118 | 99.26 | ||
| KOG1118|consensus | 366 | 99.26 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 99.24 | |
| KOG4225|consensus | 489 | 99.2 | ||
| KOG4226|consensus | 379 | 99.15 | ||
| KOG2996|consensus | 865 | 99.13 | ||
| KOG2856|consensus | 472 | 99.12 | ||
| KOG4226|consensus | 379 | 99.08 | ||
| KOG0162|consensus | 1106 | 99.08 | ||
| KOG4348|consensus | 627 | 99.04 | ||
| KOG1029|consensus | 1118 | 98.92 | ||
| KOG4348|consensus | 627 | 98.86 | ||
| KOG1264|consensus | 1267 | 98.81 | ||
| KOG4225|consensus | 489 | 98.8 | ||
| KOG4792|consensus | 293 | 98.79 | ||
| KOG2546|consensus | 483 | 98.74 | ||
| KOG1843|consensus | 473 | 98.7 | ||
| KOG3655|consensus | 484 | 98.61 | ||
| KOG3875|consensus | 362 | 98.61 | ||
| KOG1702|consensus | 264 | 98.44 | ||
| KOG3601|consensus | 222 | 98.38 | ||
| KOG4278|consensus | 1157 | 98.34 | ||
| KOG3632|consensus | 1335 | 98.12 | ||
| KOG3557|consensus | 721 | 98.03 | ||
| KOG2222|consensus | 848 | 97.98 | ||
| KOG3523|consensus | 695 | 97.98 | ||
| KOG2528|consensus | 490 | 97.97 | ||
| KOG4773|consensus | 386 | 97.7 | ||
| KOG4792|consensus | 293 | 97.58 | ||
| KOG0197|consensus | 468 | 97.53 | ||
| KOG3725|consensus | 375 | 97.43 | ||
| KOG4575|consensus | 874 | 97.43 | ||
| KOG3771|consensus | 460 | 97.43 | ||
| KOG1451|consensus | 812 | 97.41 | ||
| KOG0609|consensus | 542 | 97.39 | ||
| KOG3601|consensus | 222 | 97.16 | ||
| KOG4429|consensus | 421 | 96.95 | ||
| KOG3775|consensus | 482 | 96.76 | ||
| KOG3565|consensus | 640 | 96.39 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 96.36 | |
| KOG3632|consensus | 1335 | 96.15 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 95.3 | |
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 95.21 | |
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 95.21 | |
| KOG0199|consensus | 1039 | 94.97 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.81 | |
| KOG0040|consensus | 2399 | 93.81 | ||
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 93.43 | |
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 93.29 | |
| KOG2996|consensus | 865 | 91.36 | ||
| KOG3812|consensus | 475 | 90.31 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 89.77 | |
| KOG3705|consensus | 580 | 88.86 | ||
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 87.96 | |
| COG3103 | 205 | SH3 domain protein [Signal transduction mechanisms | 85.17 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 83.26 | |
| KOG0505|consensus | 527 | 82.5 |
| >KOG0515|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-35 Score=238.74 Aligned_cols=129 Identities=52% Similarity=0.973 Sum_probs=124.9
Q ss_pred hhhhhcCCCchhhhhh-cccceecccccCChhhhhhhhccccCCcccccchhhhhHhhhcccCCcceEEeeccCCCCCCC
Q psy7685 7 QKIHFTCTTLAVCSLS-FVLYCIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDE 85 (137)
Q Consensus 7 ~~~~a~~~~~~~~~~l-~~g~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~al~dy~~~~~~e 85 (137)
.|||||||++++|++| ++|++|||+|.||.+|++++|++.+++|..|++|++.++++++.++.+.+.|+|||+++..||
T Consensus 620 LHCAASCNnv~~ckqLVe~GaavfAsTlSDmeTa~eKCee~eeGY~~CsqyL~~vqesmG~mN~G~vYAlwdYeaqf~DE 699 (752)
T KOG0515|consen 620 LHCAASCNNVPMCKQLVESGAAVFASTLSDMETAAEKCEEMEEGYDQCSQYLYGVQESMGSMNKGVVYALWDYEAQFEDE 699 (752)
T ss_pred hhhhhhcCchHHHHHHHhccceEEeeecccccchhhhcchhhhhHHHHHHHHHHHHHhhcccccceeEEeeccccccccc
Confidence 5999999999999999 999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCEEEEEEecCCCCCCeEEEEeCCeeEEEcCCCeeecCCCCCCCC
Q psy7685 86 LSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSAT 135 (137)
Q Consensus 86 Ls~~~Gd~i~vl~~~~~~~~gWw~g~~~g~~G~~P~~yv~~~~~~~~~~~ 135 (137)
|+|+.||.++||+++++.+..||+++++|++|+||.||+..++..+|+..
T Consensus 700 Lsf~eGd~lTvirr~d~~eteWWwa~lng~eGyVPRnylgLyPriKprqr 749 (752)
T KOG0515|consen 700 LSFDEGDELTVIRRDDEVETEWWWARLNGEEGYVPRNYLGLYPRIKPRQR 749 (752)
T ss_pred ccccCCceeEEEecCCcchhhhhhHhhcCcccccchhhhhcCccccchhh
Confidence 99999999999999888788899999999999999999999999988753
|
|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >COG3103 SH3 domain protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 137 | ||||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 2e-32 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 2e-32 | ||
| 2vge_A | 229 | Crystal Structure Of The C-Terminal Region Of Human | 4e-25 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 6e-08 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 7e-08 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 8e-08 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 3e-07 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 4e-07 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 7e-07 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 2e-06 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 2e-06 | ||
| 2pz1_A | 466 | Crystal Structure Of Auto-Inhibited Asef Length = 4 | 4e-06 | ||
| 1wyx_A | 69 | The Crystal Structure Of The P130cas Sh3 Domain At | 4e-06 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 5e-06 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 5e-06 | ||
| 1oeb_A | 62 | MonaGADS SH3C DOMAIN Length = 62 | 5e-06 | ||
| 2oi3_A | 86 | Nmr Structure Analysis Of The Hematopoetic Cell Kin | 6e-06 | ||
| 2d0n_A | 59 | Crystal Structure Of The C-Terminal Sh3 Domain Of T | 7e-06 | ||
| 2dx1_A | 482 | Crystal Structure Of Rhogef Protein Asef Length = 4 | 7e-06 | ||
| 4hck_A | 72 | Human Hck Sh3 Domain, Nmr, 25 Structures Length = 7 | 7e-06 | ||
| 1uti_A | 58 | MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L | 7e-06 | ||
| 3nhn_A | 193 | Crystal Structure Of The Src-Family Kinase Hck Sh3- | 7e-06 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 7e-06 | ||
| 1h3h_A | 60 | Structural Basis For Specific Recognition Of An Rxx | 7e-06 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 7e-06 | ||
| 1bu1_A | 57 | Src Family Kinase Hck Sh3 Domain Length = 57 | 7e-06 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 7e-06 | ||
| 1aze_A | 56 | Nmr Structure Of The Complex Between The C32s-Y7v M | 8e-06 | ||
| 3nmz_D | 116 | Crytal Structure Of Apc Complexed With Asef Length | 1e-05 | ||
| 4esr_A | 69 | Molecular And Structural Characterization Of The Sh | 1e-05 | ||
| 2dl7_A | 73 | Solution Structure Of The Second Sh3 Domain Of Huma | 1e-05 | ||
| 1wa7_A | 65 | Sh3 Domain Of Human Lyn Tyrosine Kinase Length = 65 | 2e-05 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 2e-05 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 2e-05 | ||
| 2xmf_A | 60 | Myosin 1e Sh3 Length = 60 | 2e-05 | ||
| 1x2q_A | 88 | Solution Structure Of The Sh3 Domain Of The Signal | 2e-05 | ||
| 2jte_A | 64 | Third Sh3 Domain Of Cd2ap Length = 64 | 3e-05 | ||
| 2ysq_A | 81 | Solution Structure Of The Sh3 Domain From Rho Guani | 3e-05 | ||
| 2hda_A | 64 | Yes Sh3 Domain Length = 64 | 3e-05 | ||
| 3reb_B | 90 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 3e-05 | ||
| 2kgt_A | 72 | Solution Structure Of Sh3 Domain Of Ptk6 Length = 7 | 4e-05 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 4e-05 | ||
| 2l0a_A | 72 | Solution Nmr Structure Of Signal Transducing Adapte | 4e-05 | ||
| 2x3w_D | 60 | Structure Of Mouse Syndapin I (Crystal Form 2) Leng | 4e-05 | ||
| 3rea_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 5e-05 | ||
| 2dil_A | 69 | Solution Structure Of The Sh3 Domain Of The Human P | 5e-05 | ||
| 2ydl_A | 69 | Crystal Structure Of Sh3c From Cin85 Length = 69 | 5e-05 | ||
| 1x2p_A | 68 | Solution Structure Of The Sh3 Domain Of The Protein | 6e-05 | ||
| 2yun_A | 79 | Solution Structure Of The Sh3 Domain Of Human Nostr | 7e-05 | ||
| 3haj_A | 486 | Crystal Structure Of Human Pacsin2 F-Bar Domain (P2 | 7e-05 | ||
| 3m0p_A | 62 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 7e-05 | ||
| 3m0s_A | 57 | Crystal Structure Of The R21d Mutant Of Alpha-Spect | 7e-05 | ||
| 2k2m_A | 68 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 7e-05 | ||
| 2k6d_A | 62 | Cin85 Sh3-C Domain In Complex With Ubiquitin Length | 8e-05 | ||
| 2k9g_A | 73 | Solution Structure Of The Third Sh3 Domain Of The C | 9e-05 | ||
| 2d8h_A | 80 | Solution Structure Of The Sh3 Domain Of Hypothetica | 9e-05 | ||
| 1a0n_B | 69 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 1e-04 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 1e-04 | ||
| 1azg_B | 67 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 1e-04 | ||
| 2dbm_A | 73 | Solution Structures Of The Sh3 Domain Of Human Sh3- | 1e-04 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-04 | ||
| 3iql_A | 71 | Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma | 2e-04 | ||
| 1uhc_A | 79 | Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of | 2e-04 | ||
| 2vvk_A | 56 | Grb2 Sh3c (1) Length = 56 | 2e-04 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 2e-04 | ||
| 2a37_A | 59 | Solution Structure Of The T22g Mutant Of N-Terminal | 2e-04 | ||
| 1hd3_A | 62 | A-Spectrin Sh3 Domain F52y Mutant Length = 62 | 2e-04 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 2e-04 | ||
| 2bz8_A | 58 | N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti | 3e-04 | ||
| 3c0c_A | 73 | X-Ray Crystal Structure Of The Rat Endophilin A2 Sh | 3e-04 | ||
| 1m27_C | 61 | Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX | 3e-04 | ||
| 2rol_A | 64 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 3e-04 | ||
| 1avz_C | 57 | V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D | 3e-04 | ||
| 3thk_A | 73 | Structure Of Sh3 Chimera With A Type Ii Ligand Link | 3e-04 | ||
| 1shf_A | 59 | Crystal Structure Of The Sh3 Domain In Human Fyn; C | 3e-04 | ||
| 3h0h_A | 73 | Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le | 3e-04 | ||
| 1uue_A | 62 | A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = | 3e-04 | ||
| 2da9_A | 70 | Solution Structure Of The Third Sh3 Domain Of Sh3-D | 3e-04 | ||
| 2krn_A | 60 | High Resolution Structure Of The Second Sh3 Domain | 4e-04 | ||
| 2ed1_A | 76 | Solution Structure Of The Sh3 Domain Of 130 Kda Pho | 4e-04 | ||
| 2ed0_A | 78 | Solution Structure Of The Sh3 Domain Of Abl Interac | 4e-04 | ||
| 1pwt_A | 61 | Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw | 4e-04 | ||
| 1neg_A | 83 | Crystal Structure Analysis Of N-And C-Terminal Labe | 4e-04 | ||
| 2f2x_A | 62 | Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | 5e-04 | ||
| 3i9q_A | 57 | Crystal Structure Of The Triple Mutant S19g-P20d-R2 | 5e-04 | ||
| 2lj3_A | 63 | Pfbd: High-Throughput Strategy Of Backbone Fold Det | 5e-04 | ||
| 1m8m_A | 62 | Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 | 5e-04 | ||
| 2cdt_A | 62 | Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | 6e-04 | ||
| 2f2v_A | 62 | Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | 6e-04 | ||
| 2f2w_A | 62 | Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | 6e-04 | ||
| 1efn_A | 59 | Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S | 6e-04 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 7e-04 | ||
| 3h0f_A | 73 | Crystal Structure Of The Human Fyn Sh3 R96w Mutant | 7e-04 | ||
| 1wxb_A | 68 | Solution Structure Of The Sh3 Domain From Human Epi | 7e-04 | ||
| 1bk2_A | 57 | A-Spectrin Sh3 Domain D48g Mutant Length = 57 | 7e-04 | ||
| 3rbb_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck Sh | 8e-04 | ||
| 3cqt_A | 79 | N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | 8e-04 |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
|
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 | Back alignment and structure |
| >pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 | Back alignment and structure |
| >pdb|2OI3|A Chain A, Nmr Structure Analysis Of The Hematopoetic Cell Kinase Sh3 Domain Complexed With An Artificial High Affinity Ligand (Pd1) Length = 86 | Back alignment and structure |
| >pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 | Back alignment and structure |
| >pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 | Back alignment and structure |
| >pdb|4HCK|A Chain A, Human Hck Sh3 Domain, Nmr, 25 Structures Length = 72 | Back alignment and structure |
| >pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 | Back alignment and structure |
| >pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|1BU1|A Chain A, Src Family Kinase Hck Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 | Back alignment and structure |
| >pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 | Back alignment and structure |
| >pdb|4ESR|A Chain A, Molecular And Structural Characterization Of The Sh3 Domain Of Ahi-1 In Regulation Of Cellular Resistance Of Bcr-Abl+ Chronic Myeloid Leukemia Cells To Tyrosine Kinase Inhibitors Length = 69 | Back alignment and structure |
| >pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 | Back alignment and structure |
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 | Back alignment and structure |
| >pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 | Back alignment and structure |
| >pdb|2JTE|A Chain A, Third Sh3 Domain Of Cd2ap Length = 64 | Back alignment and structure |
| >pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 | Back alignment and structure |
| >pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 | Back alignment and structure |
| >pdb|2KGT|A Chain A, Solution Structure Of Sh3 Domain Of Ptk6 Length = 72 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 | Back alignment and structure |
| >pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 | Back alignment and structure |
| >pdb|3REA|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 | Back alignment and structure |
| >pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 | Back alignment and structure |
| >pdb|1X2P|A Chain A, Solution Structure Of The Sh3 Domain Of The Protein Arginine N-Methyltransferase 2 Length = 68 | Back alignment and structure |
| >pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 | Back alignment and structure |
| >pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) Length = 486 | Back alignment and structure |
| >pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 | Back alignment and structure |
| >pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 | Back alignment and structure |
| >pdb|2K2M|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 68 | Back alignment and structure |
| >pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 | Back alignment and structure |
| >pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 | Back alignment and structure |
| >pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 | Back alignment and structure |
| >pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 | Back alignment and structure |
| >pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 | Back alignment and structure |
| >pdb|1UHC|A Chain A, Solution Structure Of Rsgi Ruh-002, A Sh3 Domain Of Kiaa1010 Protein [homo Sapiens] Length = 79 | Back alignment and structure |
| >pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|2A37|A Chain A, Solution Structure Of The T22g Mutant Of N-Terminal Sh3 Domain Of Drk (Drkn Sh3 Domain) Length = 59 | Back alignment and structure |
| >pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 | Back alignment and structure |
| >pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 | Back alignment and structure |
| >pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 | Back alignment and structure |
| >pdb|2ROL|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 64 | Back alignment and structure |
| >pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 | Back alignment and structure |
| >pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 | Back alignment and structure |
| >pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 | Back alignment and structure |
| >pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 | Back alignment and structure |
| >pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 | Back alignment and structure |
| >pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 | Back alignment and structure |
| >pdb|2ED1|A Chain A, Solution Structure Of The Sh3 Domain Of 130 Kda Phosphatidylinositol 4,5-Biphosphate-Dependent Arf1 Gtpase- Activating Protein Length = 76 | Back alignment and structure |
| >pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 | Back alignment and structure |
| >pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 | Back alignment and structure |
| >pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 | Back alignment and structure |
| >pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 | Back alignment and structure |
| >pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 | Back alignment and structure |
| >pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 | Back alignment and structure |
| >pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 | Back alignment and structure |
| >pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 | Back alignment and structure |
| >pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 | Back alignment and structure |
| >pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 | Back alignment and structure |
| >pdb|1WXB|A Chain A, Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein Length = 68 | Back alignment and structure |
| >pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 | Back alignment and structure |
| >pdb|3RBB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|3CQT|A Chain A, N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 137 | |||
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-36 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-28 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 2e-23 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 4e-23 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 1e-19 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 8e-19 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 9e-19 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 1e-18 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 2e-18 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 2e-18 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-18 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 4e-18 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 4e-18 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 6e-18 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 8e-18 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 9e-18 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 1e-17 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-17 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 1e-17 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 1e-17 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 1e-17 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-17 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 2e-17 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 2e-17 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 3e-17 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 4e-17 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 4e-17 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 5e-17 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 5e-17 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 5e-17 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 6e-17 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 6e-17 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 7e-17 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 8e-17 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 9e-17 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 9e-17 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 1e-16 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 1e-16 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 1e-16 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 1e-16 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 1e-16 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 1e-16 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 1e-16 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 2e-16 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 2e-16 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 2e-16 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 2e-16 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 2e-16 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 2e-16 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 2e-16 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 3e-16 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 3e-16 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 3e-16 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 3e-16 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 3e-16 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 3e-16 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 4e-16 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 4e-16 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 4e-16 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 4e-16 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 5e-16 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 6e-16 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 6e-16 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 6e-16 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 7e-16 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 8e-16 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 9e-16 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 1e-15 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 1e-15 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 1e-15 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 1e-15 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 1e-15 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 1e-15 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 1e-15 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 1e-15 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 1e-15 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 1e-15 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 2e-15 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 2e-15 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 2e-15 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 2e-15 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 2e-15 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 2e-15 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 3e-15 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 3e-15 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 3e-15 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 3e-15 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 3e-15 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 3e-15 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 3e-15 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 3e-15 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 3e-15 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 3e-15 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 4e-15 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 4e-15 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 5e-15 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 5e-15 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 5e-15 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 9e-15 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 5e-15 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 6e-15 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 6e-15 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 6e-15 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 7e-15 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 7e-15 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 7e-15 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 8e-15 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 8e-15 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 8e-15 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 8e-15 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 8e-15 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 9e-15 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 1e-14 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 1e-14 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 1e-14 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 1e-14 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 1e-14 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 1e-14 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-14 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 2e-14 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-14 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 2e-14 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 3e-14 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 4e-14 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 7e-14 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 7e-14 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 8e-14 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 9e-14 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 1e-13 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-13 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 7e-12 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 2e-13 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 2e-13 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 2e-13 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 2e-13 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 2e-13 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 4e-13 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 4e-13 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 5e-13 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 6e-13 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 8e-13 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 9e-13 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 1e-12 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 1e-12 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 1e-12 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 2e-12 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 2e-12 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 2e-12 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 2e-12 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-12 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 2e-12 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 3e-12 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 3e-12 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 4e-12 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 4e-12 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 4e-12 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 5e-12 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 5e-12 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 8e-08 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 5e-12 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 5e-12 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 1e-11 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 2e-11 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 2e-11 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 2e-11 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 3e-11 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 4e-11 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 4e-11 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 7e-11 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 1e-10 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 2e-10 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-10 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 2e-07 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-10 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 3e-10 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 3e-10 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 3e-10 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 3e-10 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 4e-10 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 6e-10 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 9e-10 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 8e-08 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 1e-09 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 1e-09 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 2e-09 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-09 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 7e-09 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 2e-08 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 4e-08 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 5e-08 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 3e-07 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 6e-07 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 2e-06 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 4e-05 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 4e-05 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 7e-05 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 9e-05 |
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
Score = 123 bits (312), Expect = 2e-36
Identities = 66/110 (60%), Positives = 86/110 (78%)
Query: 27 CIFATTHSDHETAAVKCEEDEEGFEGCSEFLYSVQEKLGILNNGAVYALYDYEANNTDEL 86
+FA T+SD +TAA KCEE EEG+ CS+FLY VQEK+GI+N G +YAL+DYE N DEL
Sbjct: 128 AVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDEL 187
Query: 87 SFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYPRVQPSATP 136
K G+C+ ++ + DE+E EWWW++LN+KEGYVPRNLLGLYPR++P
Sbjct: 188 PMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRS 237
|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Length = 96 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.75 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.71 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.7 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.7 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.69 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.68 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.67 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.67 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.67 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.67 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.66 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.66 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.66 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.66 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.66 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.66 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.66 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.65 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.65 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.65 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.65 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.65 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.65 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.65 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.65 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.64 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.64 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.64 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.64 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.64 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.64 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.64 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.64 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.64 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.64 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.64 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.64 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.64 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.64 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.63 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.63 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.63 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.63 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.63 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.63 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.63 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.63 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.63 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.63 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.63 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.63 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.63 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.63 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.63 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.63 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.63 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.63 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.63 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.63 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.63 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.63 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.63 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.62 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.62 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.62 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.62 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.62 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.62 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.62 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.62 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.62 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.62 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.62 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.62 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.62 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.62 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.62 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.61 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.61 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.61 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.61 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.61 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.61 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.61 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.61 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.61 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.61 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.61 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.61 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.61 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.61 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.6 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.6 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.6 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.6 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.6 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.6 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.6 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.6 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.6 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.6 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.6 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.6 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.6 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.6 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.6 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.6 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.59 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.59 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.59 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.59 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.59 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.59 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.59 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.59 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.59 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.59 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.59 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.59 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.58 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.58 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.58 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.58 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.58 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.58 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.58 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.58 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.58 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.58 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.58 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.58 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.58 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.58 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.57 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.57 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.57 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.57 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.57 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.57 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.57 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.57 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.56 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.56 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.56 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.55 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.55 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.55 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.54 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.54 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.54 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.54 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.53 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.53 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.53 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.52 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.52 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.51 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.51 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.5 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.49 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.48 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.48 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.47 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.46 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.46 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.45 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.44 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.42 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.4 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.39 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.38 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.38 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.37 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.37 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.36 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.34 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.34 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.33 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.33 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.31 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 99.31 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.3 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.28 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 99.28 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 99.28 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.25 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.22 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.2 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 99.19 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.18 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.18 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.17 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.17 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.79 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.7 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 99.11 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.1 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.08 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.0 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 99.0 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.95 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 98.94 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.88 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 98.85 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 98.76 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 98.58 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.56 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 98.42 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.42 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 98.38 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.36 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 98.22 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 98.18 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.81 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 97.68 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 96.67 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 96.57 | |
| 2kq8_A | 70 | Cell WALL hydrolase; GFT protein structure, NESG, | 95.99 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 93.24 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 92.72 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 90.31 | |
| 3npf_A | 306 | Putative dipeptidyl-peptidase VI; structural genom | 83.34 |
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.75 E-value=1.4e-18 Score=103.88 Aligned_cols=57 Identities=25% Similarity=0.568 Sum_probs=50.2
Q ss_pred CCcceEEeeccCCCCCCC-CCCCCCCEEEEEEecCCCCCCeEEEE-eCCeeEEEcCCCeeec
Q psy7685 68 NNGAVYALYDYEANNTDE-LSFKTGECIIVLRKGDENEREWWWSK-LNNKEGYVPRNLLGLY 127 (137)
Q Consensus 68 ~~~~~~al~dy~~~~~~e-Ls~~~Gd~i~vl~~~~~~~~gWw~g~-~~g~~G~~P~~yv~~~ 127 (137)
.+.+++|+|||.++.++| |+|++||+|.|+++.++ |||.|+ .+|++|+||+|||+.+
T Consensus 2 sg~~~rAlydy~~~~~~e~Ls~~~Gd~i~v~~~~~~---~Ww~g~~~~G~~G~fP~nyVe~i 60 (60)
T 2lx7_A 2 SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDG---GWWEGEKEDGLRGWFPASYVQLL 60 (60)
T ss_dssp CSCEEEESCCCCSCCCSSCCCCCTTCEEEBSCCCTT---SCEEEECTTSCEEEECGGGEEEC
T ss_pred CCCEEEECcccCCCCCCCCccCCCCCEEEEeEecCC---CeEEEEeCCCCEEEEcHHHEEEC
Confidence 457899999999998887 99999999999987643 599999 5789999999999975
|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 137 | ||||
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 3e-27 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 1e-17 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 4e-17 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 7e-17 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 1e-16 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 1e-16 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 2e-16 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 2e-16 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 3e-16 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 4e-16 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 6e-16 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 6e-16 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 8e-16 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 1e-15 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-15 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 3e-15 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 4e-15 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 4e-15 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 4e-15 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 1e-14 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 1e-14 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 2e-14 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 2e-14 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 3e-14 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 4e-14 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 4e-14 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 4e-14 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 4e-14 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 6e-14 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 8e-14 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 2e-13 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 2e-13 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 3e-13 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-12 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 2e-12 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 3e-12 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 6e-12 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 2e-11 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 3e-11 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 3e-11 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 4e-11 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 4e-11 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 6e-10 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 2e-09 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 7e-09 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 4e-08 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 4e-08 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 9e-07 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 2e-05 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 5e-04 |
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: 53BP2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 94.1 bits (234), Expect = 3e-27
Identities = 39/63 (61%), Positives = 51/63 (80%)
Query: 66 ILNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLG 125
I+N G +YAL+DYE N DEL K G+C+ ++ + DE+E EWWW++LN+KEGYVPRNLLG
Sbjct: 1 IMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLG 60
Query: 126 LYP 128
LYP
Sbjct: 61 LYP 63
|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.72 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.72 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.72 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.71 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.7 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.7 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.69 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.69 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.68 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.68 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.68 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.67 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.67 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.67 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.67 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.66 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.66 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.66 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.66 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.66 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.66 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.66 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.66 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.66 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.65 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.64 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.64 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.64 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.63 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.63 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.62 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.62 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.61 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.61 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.61 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.61 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.58 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.58 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.55 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.55 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.55 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.54 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.47 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.45 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 99.27 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 99.03 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 96.99 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 96.1 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 89.54 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 84.12 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 81.73 |
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: 53BP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=8e-20 Score=108.94 Aligned_cols=62 Identities=61% Similarity=1.349 Sum_probs=55.6
Q ss_pred cCCcceEEeeccCCCCCCCCCCCCCCEEEEEEecCCCCCCeEEEEeCCeeEEEcCCCeeecC
Q psy7685 67 LNNGAVYALYDYEANNTDELSFKTGECIIVLRKGDENEREWWWSKLNNKEGYVPRNLLGLYP 128 (137)
Q Consensus 67 ~~~~~~~al~dy~~~~~~eLs~~~Gd~i~vl~~~~~~~~gWw~g~~~g~~G~~P~~yv~~~~ 128 (137)
++.+.++|+|||.++.++||+|++||+|.|+++.+++..|||.|+.+|++|+||++||+.+|
T Consensus 2 ~n~g~v~Alydy~a~~~~ELs~~~Gd~i~vl~~~~~~~~gW~~g~~~g~~G~~P~~yv~~~P 63 (63)
T d1ycsb2 2 MNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP 63 (63)
T ss_dssp TGGGEEEESSCBCCSSTTBCCBCSSCEEEECCCCTTSCSSEEEEEETTEEEEEEGGGEECCC
T ss_pred CcCCEEEEeeCCCCCCCCCcCCCCCCEEEEEEecCCCCCCEEEEEECCeEEEEchHHhEeCc
Confidence 35567999999999999999999999999998866556689999999999999999999875
|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|