Diaphorina citri psyllid: psy768

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MAQDSAPDLDNLDDLLRYIGHTSPECLETLDTPRNIPASRSSINTELEQDTIGCILSCDKKYSTCLNFQITGHQDKHLTRVLFHQSANHQLQVFNIRVLRCFHTSQPKNALPGFIYLIFKPILRVVGAIVIARISRKWWSKLSPDQKKIILSQIKKHQDKIAGITLTSIGLAYIYYFLHLETCPITGRQKFIIVKPNQLNDVTQIAYDNFIEEHGNQVLPLGHPAYKRVGAVVKRLIDANKVYMEHNNFKYPITIIDDPLINAFVFPDGRIFMFTGMFQLCQTDDELATVLSHELSHTLLKHVAEKLSNKTFLEILYIVPLMIIWFLLPDLGAIVTQVLLDDLKSIIFELPFEREMETEADESIIFELPFEREMETEADEVGLKLMARACYDVRVAPLFWQKMALKETQDQVGPKMEEYLSTHPSHENRANNLESKMKEALDIRKECNCLPLGPLFIPRLNPLAQLFNVRPATPA
cccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccEEECcccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccc
*********DNLDDLLRYIGHTSPECLETLDTPRNIPASRSSINTELEQDTIGCILSCDKKYSTCLNFQITGHQDKHLTRVLFHQSANHQLQVFNIRVLRCFHTSQPKNALPGFIYLIFKPILRVVGAIVIARISRKWWSKLSPDQKKIILSQIKKHQDKIAGITLTSIGLAYIYYFLHLETCPITGRQKFIIVKPNQLNDVTQIAYDNFIEEHGNQVLPLGHPAYKRVGAVVKRLIDANKVYMEHNNFKYPITIIDDPLINAFVFPDGRIFMFTGMFQLCQTDDELATVLSHELSHTLLKHVAEKLSNKTFLEILYIVPLMIIWFLLPDLGAIVTQVLLDDLKSIIFELPFEREMETEADESIIFELPFEREMETEADEVGLKLMARACYDVRVAPLFWQKMAL*************YLSTHPSHENRANNLESKMKEALDIRKECNCLPLGPLFIPRLNPLAQLFNV******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDSAPDLDNLDDLLRYIGHTSPECLETLDTPRNIPASRSSINTELEQDTIGCILSCDKKYSTCLNFQITGHQDKHLTRVLFHQSANHQLQVFNIRVLRCFHTSQPKNALPGFIYLIFKPILRVVGAIVIARISRKWWSKLSPDQKKIILSQIKKHQDKIAGITLTSIGLAYIYYFLHLETCPITGRQKFIIVKPNQLNDVTQIAYDNFIEEHGNQVLPLGHPAYKRVGAVVKRLIDANKVYMEHNNFKYPITIIDDPLINAFVFPDGRIFMFTGMFQLCQTDDELATVLSHELSHTLLKHVAEKLSNKTFLEILYIVPLMIIWFLLPDLGAIVTQVLLDDLKSIIFELPFEREMETEADESIIFELPFEREMETEADEVGLKLMARACYDVRVAPLFWQKMALKETQDQVGPKMEEYLSTHPSHENRANNLESKMKEALDIRKECNCLPLGPLFIPRLNPLAQLFNVRPATPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metalloendopeptidase OMA1, mitochondrial Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions.confidentQ3SZN3
Metalloendopeptidase OMA1, mitochondrial Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of opa1 at S1 position, leading to opa1 inactivation and negative regulation of mitochondrial fusion.confidentE9QBI7
Metalloendopeptidase OMA1, mitochondrial Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions.confidentQ96E52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C37, chain A
Confidence level:very confident
Coverage over the Query: 189-347,362-405,422-440
View the alignment between query and template
View the model in PyMOL
Template: 4AW6, chain A
Confidence level:confident
Coverage over the Query: 205-436
View the alignment between query and template
View the model in PyMOL