Diaphorina citri psyllid: psy7711


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MPVFKGKPPHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDSAKSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGGKVI
ccccccccccCEEEEEEEccEEEEEEccccccHHHHHHHHHHHHccccccCEEEEcccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccHHcccccccccccccccccHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccEEEEEECccccccEEEEEEEEccccccccccEEEccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccccHHcccccccccccccccccccccEEEEEEEECcccccccccEEEEEEcccccEEEECcccEEECcHHHHHHHccccccc
********PHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLL******************************LDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNL**************TASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNL*************ITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLK****************SFIEQYFYTIMDTELKCSESET*PPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEF*************************************************GRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVFKGKPPHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDSAKSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGGKVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 14 Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).confidentP60051
Ubiquitin carboxyl-terminal hydrolase 14 Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).confidentP40826
Ubiquitin carboxyl-terminal hydrolase 14 Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).confidentQ0IIF7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0010951 [BP]negative regulation of endopeptidase activityprobableGO:0051336, GO:0051346, GO:0019222, GO:0052547, GO:0052548, GO:0050790, GO:0050789, GO:0010466, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0004221 [MF]ubiquitin thiolesterase activityprobableGO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0070628 [MF]proteasome bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0045202 [CC]synapseprobableGO:0005575
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VJV, chain A
Confidence level:very confident
Coverage over the Query: 185-303,315-451,468-576
View the alignment between query and template
View the model in PyMOL
Template: 1VJV, chain A
Confidence level:very confident
Coverage over the Query: 107-171
View the alignment between query and template
View the model in PyMOL
Template: 1WGG, chain A
Confidence level:very confident
Coverage over the Query: 8-94
View the alignment between query and template
View the model in PyMOL