Psyllid ID: psy7711

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------

MPVFKGKPPHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDSAKSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGGKVI

ccccccccccEEEEEEEEccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccHHcccccccccccccccccHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccEEEEEEEEccccccccccEEEccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccccHHcccccccccccccccccccccEEEEEEEEEcccccccccEEEEEEcccccEEEEEcccEEEEcHHHHHHHccccccc

cccccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHccccHHHcEEEEEccccccccHHHcccccccEEEEEcccccccccccccccEEEccccHHHHHHHccccccccccccHHHHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHccccccHHHcHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcEEEEEEEEEccccccccccccccEEEEEcccccccHHHHHHHHHHcHHHcccccccccccEEEEEccEccccccHcEEEEEEEEccHHccccEEEEEEccccccccHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccHHHHcccccccccccHHHHHcccccccccccccccccccEEEEEEEEccccccccccEEEEEEEccccEEEEccccEEEccHHHHHHHccccccc

mpvfkgkpphtyivkvkwgketfevdvdtdeepmLFKAQLYELTgvqidrqkvmckgatlkndewdnfklsngsmvllmgskeedsmkepvvkpkfvedmnESERAVSldlpaglnnlgntcYMNAVIQCLKTVPELRKALKNLkgglqpgsnpaqsITASLRDLYECmdnmkispsispfimlqgrylpaglnnlgntcYMNAVIQCLKTVPELRKALKNLkgglqpgsnpaqsITASLRDLYECmdnmkispsispfIMLQVLHNvfprfadktddgsymqQDANECWTEMVRMLKTalpgeneegqdsaKSSFIEQYFYTIMDTelkcsesetepptkgtesfQQLSCYITTDVKYMlpglknklqdqitkrspsldrdavyvktskvsrlpayLTIQFVRFFYKEKERINAKVlkdikfpiefdayelcTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGqkiyapvgdriqdfgvkstefqsrgqgsspgrvdigsnnsgyYTLQAVLThkgrtsssghYVAWVkkpngtwikcdddkvypisEEEVLKLSGGGKVI

mpvfkgkpphtyivkvkwgkeTFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGAtlkndewdnfklsNGSMVLLMgskeedsmkepVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNlkgglqpgsnpaQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNlkgglqpgsnpaQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPgeneegqdsaKSSFIEQYFYTIMDTELKCSESETepptkgtesfqqLSCYITTDVKYMLPGLKNKlqdqitkrspsldrdavyvktskvsrlpayltIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKSTEfqsrgqgsspgrvdigsnNSGYYTLQAVLTHKgrtsssghyvawvkkpngtwikcdddkVYPISEEevlklsgggkvi

MPVFKGKPPHTYIVKVKWGKetfevdvdtdeePMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDSAKSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMRekfkiaeekeafeefRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGGKVI

*********HTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLL******************************LDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNL**************TASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNL**************TASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLK*****************FIEQYFYTIMDTEL****************FQQLSCYITTDVKYMLPGLKNKLQ***********RDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGV***********************SGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPIS**************

********PHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSM************************************PAGLNNLGNTCYMNAVIQCLKTVPELRKALKN*************************************FIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALK***************ITASLRDLYECMDNM****SISPFIMLQVLHNVFPRFADKTDD*SYMQQDANECWTEMVRML*****************SFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDR*AVYV**SKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIA**********************************************TEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGGK**

MPVFKGKPPHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALP**********KSSFIEQYFYTIMDTELK***************FQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDRIQDFGVKS************GRVDIGSNNSGYYTLQAVLTH********HYVAWVKKPNGTWIKCDDDKVYPISEEEV**********

*****GKPPHTYIVKVKWGKETFEVDVDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKNDEWDNFKLSNGSMVLLMGSKEEDSMKEPVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQ*GSNPAQSITASLRDLYECMDNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENE*GQDSAKSSFIEQYFYTIMDTELKCSESET*PPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEF*******************************************************SNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLS******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		577	2.2.26 [Sep-21-2011]
Q0IIF7		494	Ubiquitin carboxyl-termin	yes	N/A	0.613	0.716	0.515	1e-108
Q9JMA1		493	Ubiquitin carboxyl-termin	no	N/A	0.611	0.716	0.502	1e-106
P40826		493	Ubiquitin carboxyl-termin	yes	N/A	0.613	0.718	0.503	1e-106
P54578		494	Ubiquitin carboxyl-termin	no	N/A	0.613	0.716	0.51	1e-106
P60051		493	Ubiquitin carboxyl-termin	yes	N/A	0.613	0.718	0.51	1e-106
Q949Y0		482	Ubiquitin carboxyl-termin	no	N/A	0.606	0.726	0.376	5e-62
Q84WC6		477	Ubiquitin carboxyl-termin	no	N/A	0.604	0.731	0.364	4e-59
Q92353		468	Ubiquitin carboxyl-termin	yes	N/A	0.606	0.747	0.336	9e-59
Q17361		489	Ubiquitin carboxyl-termin	yes	N/A	0.584	0.689	0.363	3e-58
P43593		499	Ubiquitin carboxyl-termin	yes	N/A	0.611	0.707	0.280	7e-42

>sp\|Q0IIF7\|UBP14_BOVIN Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus GN=USP14 PE=2 SV=3	Back alignment and function desciption

 Score =  391 bits (1005), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/400 (51%), Positives = 263/400 (65%), Gaps = 46/400 (11%)

Query: 189 LPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSN--PAQSITASLRDLYEC 246
           LP GL NLGNTCYMNA +QC+++VPEL+ ALK   G L+       AQ ITA+LRDL++ 
Sbjct: 103 LPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDS 162

Query: 247 MDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPG--- 303
           MD  K S SI P I+LQ LH  FP+FA+K + G Y+QQDANECW +M+R+L+  L     
Sbjct: 163 MD--KTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWVQMMRVLQQKLEAIED 220

Query: 304 ----ENEEGQDSA-----KSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYIT 354
               E +    SA     K S I+Q+F    +T +KC+ESE E  TKG ES  QLSC+I 
Sbjct: 221 DTVKETDSSSASAVTPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKESQLQLSCFIN 280

Query: 355 TDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERIN 414
            +VKY+  GLK +LQ++ITK+SP+L R+A+Y+K+SK+SRLPAYLTIQ VRFFYKEKE +N
Sbjct: 281 QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVN 340

Query: 415 AKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEI 474
           AKVLKD+KFP+  D YELCTPELQ K+   R KFK  E+K+  ++ +T            
Sbjct: 341 AKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKT------------ 388

Query: 475 YVRFGQKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRT 534
               G K  +P  +      VK   F            DIGSNN GYY LQAVLTH+GR+
Sbjct: 389 ----GDKDSSPQKE------VKYEPFSFAD--------DIGSNNCGYYDLQAVLTHQGRS 430

Query: 535 SSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGG 574
           SSSGHYV+WVK+    WIK DDDKV  ++ E++L+LSGGG
Sbjct: 431 SSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGG 470

Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs).
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2

>sp\|Q9JMA1\|UBP14_MOUSE Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus GN=Usp14 PE=1 SV=3	Back alignment and function description

>sp\|P40826\|UBP14_RABIT Ubiquitin carboxyl-terminal hydrolase 14 OS=Oryctolagus cuniculus GN=USP14 PE=1 SV=3	Back alignment and function description

>sp\|P54578\|UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens GN=USP14 PE=1 SV=3	Back alignment and function description

>sp\|P60051\|UBP14_PANTR Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan troglodytes GN=USP14 PE=3 SV=2	Back alignment and function description

>sp\|Q949Y0\|UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1	Back alignment and function description

>sp\|Q84WC6\|UBP7_ARATH Ubiquitin carboxyl-terminal hydrolase 7 OS=Arabidopsis thaliana GN=UBP7 PE=1 SV=1	Back alignment and function description

>sp\|Q92353\|UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp6 PE=1 SV=2	Back alignment and function description

>sp\|Q17361\|UBP14_CAEEL Ubiquitin carboxyl-terminal hydrolase 14 OS=Caenorhabditis elegans GN=usp-14 PE=2 SV=2	Back alignment and function description

>sp\|P43593\|UBP6_YEAST Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP6 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		577
380027733		498	PREDICTED: ubiquitin carboxyl-terminal h	0.615	0.712	0.582	1e-124
380027735		462	PREDICTED: ubiquitin carboxyl-terminal h	0.627	0.783	0.577	1e-124
328788811		462	PREDICTED: ubiquitin carboxyl-terminal h	0.627	0.783	0.579	1e-123
328788813		498	PREDICTED: ubiquitin carboxyl-terminal h	0.615	0.712	0.584	1e-123
340716507		497	PREDICTED: ubiquitin carboxyl-terminal h	0.615	0.714	0.575	1e-122
340716509		461	PREDICTED: ubiquitin carboxyl-terminal h	0.627	0.785	0.565	1e-122
350404532		497	PREDICTED: ubiquitin carboxyl-terminal h	0.615	0.714	0.570	1e-122
350404535		461	PREDICTED: ubiquitin carboxyl-terminal h	0.627	0.785	0.565	1e-122
242015482		485	ubiquitin carboxyl-terminal hydrolase, p	0.620	0.738	0.580	1e-122
307208994		493	Ubiquitin carboxyl-terminal hydrolase 14	0.616	0.722	0.574	1e-119

>gi\|380027733\|ref\|XP_003697573.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 1 [Apis florea]	Back alignment and taxonomy information

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/395 (58%), Positives = 280/395 (70%), Gaps = 40/395 (10%)

Query: 189 LPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSN----PAQSITASLRDLY 244
           LPAGL NLGNTCY+NA +QCLKTVPELR ALKN  GGL    +    PAQSITA+LRDLY
Sbjct: 104 LPAGLTNLGNTCYLNATVQCLKTVPELRDALKNFPGGLAAAGSSSLVPAQSITAALRDLY 163

Query: 245 ECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPG- 303
           + MD     P   P +++Q++H  FPRFA+K++ G + QQDANECWTE++RML+  LP  
Sbjct: 164 DSMDKGSALP---PVVLVQMMHLAFPRFAEKSEHGGFQQQDANECWTELIRMLQQKLPAK 220

Query: 304 ENEEGQDSAKS----SFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYITTDVKY 359
           EN   +++ +S    S IEQYF    DTELKC ESE EPPTKG E F QLSC+I+T+VKY
Sbjct: 221 ENPASENNGQSYKPRSLIEQYFGGTFDTELKCIESEDEPPTKGREEFLQLSCFISTEVKY 280

Query: 360 MLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLK 419
           M  GL+NK+Q+QITK SP+L RDA+Y KTSK+SRLPAYLTIQFVRF+YKEKE INAK+LK
Sbjct: 281 MHSGLRNKMQEQITKMSPTLGRDAMYTKTSKISRLPAYLTIQFVRFYYKEKEAINAKILK 340

Query: 420 DIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFG 479
           D+KFP+EFD +ELC+ ELQ KL PMREKFK  E++   EE R                  
Sbjct: 341 DVKFPLEFDVFELCSSELQNKLIPMREKFKEHEDR-LVEESRN----------------- 382

Query: 480 QKIYAPVGDRIQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGH 539
                     I+D   K+   +   Q S     DIGSNNSGYY+LQAVLTH+GR+SSSGH
Sbjct: 383 ----------IKDRKDKTDNKKKVKQESFWFPDDIGSNNSGYYSLQAVLTHRGRSSSSGH 432

Query: 540 YVAWVKKPNGTWIKCDDDKVYPISEEEVLKLSGGG 574
           YVAWV++ N TW+KCDD+ V  ++ EEVLKLSGGG
Sbjct: 433 YVAWVRQKNDTWLKCDDENVSAVTSEEVLKLSGGG 467

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|380027735\|ref\|XP_003697574.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 2 [Apis florea]	Back alignment and taxonomy information

>gi\|328788811\|ref\|XP_003251187.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 1 [Apis mellifera]	Back alignment and taxonomy information

>gi\|328788813\|ref\|XP_395043.3\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 2 [Apis mellifera]	Back alignment and taxonomy information

>gi\|340716507\|ref\|XP_003396739.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 1 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|340716509\|ref\|XP_003396740.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 2 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|350404532\|ref\|XP_003487135.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 1 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|350404535\|ref\|XP_003487136.1\| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like isoform 2 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|242015482\|ref\|XP_002428382.1\| ubiquitin carboxyl-terminal hydrolase, putative [Pediculus humanus corporis] gi\|212512994\|gb\|EEB15644.1\| ubiquitin carboxyl-terminal hydrolase, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|307208994\|gb\|EFN86194.1\| Ubiquitin carboxyl-terminal hydrolase 14 [Harpegnathos saltator]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		577
UNIPROTKB\|J3QRZ5		459	USP14 "Ubiquitin carboxyl-term	0.454	0.570	0.543	8.2e-114
UNIPROTKB\|A6NJA2		448	USP14 "Ubiquitin carboxyl-term	0.441	0.569	0.553	1.7e-109
ZFIN\|ZDB-GENE-030131-7676		489	usp14 "ubiquitin specific prot	0.441	0.521	0.581	3.2e-102
MGI\|MGI:1928898		493	Usp14 "ubiquitin specific pept	0.441	0.517	0.557	9.7e-99
UNIPROTKB\|E1C4M6		492	USP14 "Ubiquitin carboxyl-term	0.441	0.518	0.557	1.2e-98
UNIPROTKB\|Q0IIF7		494	USP14 "Ubiquitin carboxyl-term	0.441	0.516	0.557	2.6e-98
UNIPROTKB\|F1MJV5		494	USP14 "Ubiquitin carboxyl-term	0.441	0.516	0.557	4.2e-98
RGD\|1311825		493	Usp14 "ubiquitin specific pept	0.441	0.517	0.557	4.2e-98
UNIPROTKB\|E2RPS0		545	USP14 "Ubiquitin carboxyl-term	0.441	0.467	0.553	6.8e-98
UNIPROTKB\|P54578		494	USP14 "Ubiquitin carboxyl-term	0.441	0.516	0.553	8.7e-98

UNIPROTKB\|J3QRZ5 USP14 "Ubiquitin carboxyl-terminal hydrolase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 755 (270.8 bits), Expect = 8.2e-114, Sum P(3) = 8.2e-114
 Identities = 151/278 (54%), Positives = 195/278 (70%)

Query:   182 IMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSN--PAQSITAS 239
             I ++   LP GL NLGNTCYMNA +QC+++VPEL+ ALK   G L+       AQ ITA+
Sbjct:    61 IKIKNMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAA 120

Query:   240 LRDLYECMDNMKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKT 299
             LRDL++ MD  K S SI P I+LQ LH  FP+FA+K + G Y+QQDANECW +M+R+L+ 
Sbjct:   121 LRDLFDSMD--KTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQ 178

Query:   300 ALPG-------ENEEGQDSA-----KSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQ 347
              L         E +    SA     K S I+Q+F    +T +KC+ESE E  TKG E+  
Sbjct:   179 KLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQL 238

Query:   348 QLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFY 407
             QLSC+I  +VKY+  GLK +LQ++ITK+SP+L R+A+Y+K+SK+SRLPAYLTIQ VRFFY
Sbjct:   239 QLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFY 298

Query:   408 KEKERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMR 445
             KEKE +NAKVLKD+KFP+  D YELCTPELQ K+   R
Sbjct:   299 KEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFR 336

GO:0004221 "ubiquitin thiolesterase activity" evidence=IEA

GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA

GO:0008234 "cysteine-type peptidase activity" evidence=IEA

UNIPROTKB\|A6NJA2 USP14 "Ubiquitin carboxyl-terminal hydrolase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-7676 usp14 "ubiquitin specific protease 14 (tRNA-guanine transglycosylase)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1928898 Usp14 "ubiquitin specific peptidase 14" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C4M6 USP14 "Ubiquitin carboxyl-terminal hydrolase" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0IIF7 USP14 "Ubiquitin carboxyl-terminal hydrolase 14" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MJV5 USP14 "Ubiquitin carboxyl-terminal hydrolase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1311825 Usp14 "ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RPS0 USP14 "Ubiquitin carboxyl-terminal hydrolase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P54578 USP14 "Ubiquitin carboxyl-terminal hydrolase 14" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P60051	UBP14_PANTR	3, ., 4, ., 1, 9, ., 1, 2	0.51	0.6135	0.7180	yes	N/A
P40826	UBP14_RABIT	3, ., 4, ., 1, 9, ., 1, 2	0.5037	0.6135	0.7180	yes	N/A
Q92353	UBP6_SCHPO	3, ., 4, ., 1, 9, ., 1, 2	0.3367	0.6065	0.7478	yes	N/A
Q0IIF7	UBP14_BOVIN	3, ., 4, ., 1, 9, ., 1, 2	0.515	0.6135	0.7165	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.4.19	0.921
3rd Layer	3.4.19.12	0.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		577
cd02657		305	cd02657, Peptidase_C19A, A subfamily of Peptidase	3e-99
pfam00443		313	pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol	1e-41
cd02657		305	cd02657, Peptidase_C19A, A subfamily of Peptidase	2e-23
cd02657		305	cd02657, Peptidase_C19A, A subfamily of Peptidase	7e-20
cd02660		328	cd02660, Peptidase_C19D, A subfamily of Peptidase	6e-17
cd02257		255	cd02257, Peptidase_C19, Peptidase C19 contains ubi	1e-16
cd02257		255	cd02257, Peptidase_C19, Peptidase C19 contains ubi	2e-16
pfam00443		313	pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol	3e-15
cd02661		304	cd02661, Peptidase_C19E, A subfamily of Peptidase	8e-14
pfam00443		313	pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol	9e-14
cd02661		304	cd02661, Peptidase_C19E, A subfamily of Peptidase	5e-13
COG5533		415	COG5533, UBP5, Ubiquitin C-terminal hydrolase [Pos	8e-12
cd02663		300	cd02663, Peptidase_C19G, A subfamily of Peptidase	1e-11
cd02659		334	cd02659, peptidase_C19C, A subfamily of Peptidase	2e-11
cd02667		279	cd02667, Peptidase_C19K, A subfamily of Peptidase	1e-10
cd02674		230	cd02674, Peptidase_C19R, A subfamily of peptidase	2e-09
cd02668		324	cd02668, Peptidase_C19L, A subfamily of Peptidase	2e-08
cd02658		311	cd02658, Peptidase_C19B, A subfamily of Peptidase	3e-08
cd02671		332	cd02671, Peptidase_C19O, A subfamily of Peptidase	6e-08
cd02664		327	cd02664, Peptidase_C19H, A subfamily of Peptidase	1e-07
cd02659		334	cd02659, peptidase_C19C, A subfamily of Peptidase	2e-07
cd02668		324	cd02668, Peptidase_C19L, A subfamily of Peptidase	2e-07
cd02257		255	cd02257, Peptidase_C19, Peptidase C19 contains ubi	3e-07
cd02674		230	cd02674, Peptidase_C19R, A subfamily of peptidase	3e-07
cd02674		230	cd02674, Peptidase_C19R, A subfamily of peptidase	3e-07
COG5207		749	COG5207, UBP14, Isopeptidase T [Posttranslational	3e-07
cd02257		255	cd02257, Peptidase_C19, Peptidase C19 contains ubi	4e-07
cd02658		311	cd02658, Peptidase_C19B, A subfamily of Peptidase	4e-07
cd02658		311	cd02658, Peptidase_C19B, A subfamily of Peptidase	4e-07
cd02673		245	cd02673, Peptidase_C19Q, A subfamily of Peptidase	4e-07
smart00213		72	smart00213, UBQ, Ubiquitin homologues	5e-07
cd02661		304	cd02661, Peptidase_C19E, A subfamily of Peptidase	1e-06
cd02671		332	cd02671, Peptidase_C19O, A subfamily of Peptidase	2e-06
cd02671		332	cd02671, Peptidase_C19O, A subfamily of Peptidase	3e-06
cd02663		300	cd02663, Peptidase_C19G, A subfamily of Peptidase	5e-06
COG5560		823	COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po	5e-06
cd02659		334	cd02659, peptidase_C19C, A subfamily of Peptidase	8e-06
cd02666		343	cd02666, Peptidase_C19J, A subfamily of Peptidase	1e-05
cd02666		343	cd02666, Peptidase_C19J, A subfamily of Peptidase	1e-05
COG5533		415	COG5533, UBP5, Ubiquitin C-terminal hydrolase [Pos	2e-05
COG5560		823	COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po	4e-05
COG5560		823	COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po	4e-05
cd02662		240	cd02662, Peptidase_C19F, A subfamily of Peptidase	5e-05
cd02662		240	cd02662, Peptidase_C19F, A subfamily of Peptidase	5e-05
cd02667		279	cd02667, Peptidase_C19K, A subfamily of Peptidase	8e-05
cd02660		328	cd02660, Peptidase_C19D, A subfamily of Peptidase	1e-04
cd02664		327	cd02664, Peptidase_C19H, A subfamily of Peptidase	2e-04
COG5077		1089	COG5077, COG5077, Ubiquitin carboxyl-terminal hydr	4e-04
cd01812		71	cd01812, BAG1_N, Ubiquitin-like domain of BAG1	4e-04
cd02669		440	cd02669, Peptidase_C19M, A subfamily of Peptidase	7e-04
cd02662		240	cd02662, Peptidase_C19F, A subfamily of Peptidase	0.001
cd02665		228	cd02665, Peptidase_C19I, A subfamily of Peptidase	0.001
cd02668		324	cd02668, Peptidase_C19L, A subfamily of Peptidase	0.002
cd02666		343	cd02666, Peptidase_C19J, A subfamily of Peptidase	0.003
cd02663		300	cd02663, Peptidase_C19G, A subfamily of Peptidase	0.004
cd01769		69	cd01769, UBL, Ubiquitin-like domain of UBL	0.004

>gnl\|CDD\|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19	Back alignment and domain information

 Score =  303 bits (778), Expect = 3e-99
 Identities = 122/254 (48%), Positives = 169/254 (66%), Gaps = 15/254 (5%)

Query: 192 GLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDNMK 251
           GL NLGNTCY+N+ +QCL++VPELR ALKN     +  +  + ++T +LRDL++ MD  K
Sbjct: 1   GLTNLGNTCYLNSTLQCLRSVPELRDALKNYNPARRGANQSSDNLTNALRDLFDTMDK-K 59

Query: 252 ISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDS 311
             P + P   LQ+L   FP+FA+K + G Y QQDA ECW++++ +L   LPG        
Sbjct: 60  QEP-VPPIEFLQLLRMAFPQFAEKQNQGGYAQQDAEECWSQLLSVLSQKLPG------AG 112

Query: 312 AKSSFIEQYFYTIMDTELKCSESETEPPTKGTESFQQLSCYI--TTDVKYMLPGLKNKLQ 369
           +K SFI+Q F   ++T++KC+ES  E     TES  +L C+I  TT+V Y+  GLK  L+
Sbjct: 113 SKGSFIDQLFGIELETKMKCTESPDEEEVS-TESEYKLQCHISITTEVNYLQDGLKKGLE 171

Query: 370 DQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKEKERINAKVLKDIKFPIEFDA 429
           ++I K SP+L RDA+Y KTS++SRLP YLT+QFVRFF+K   +  AK+L+ +KFP E D 
Sbjct: 172 EEIEKHSPTLGRDAIYTKTSRISRLPKYLTVQFVRFFWKRDIQKKAKILRKVKFPFELDL 231

Query: 430 YELCTP----ELQA 439
           YELCTP    EL A
Sbjct: 232 YELCTPSGYYELVA 245

Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 305

>gnl\|CDD\|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase	Back alignment and domain information

>gnl\|CDD\|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>gnl\|CDD\|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>gnl\|CDD\|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase	Back alignment and domain information

>gnl\|CDD\|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase	Back alignment and domain information

>gnl\|CDD\|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|227820 COG5533, UBP5, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239128 cd02663, Peptidase_C19G, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239132 cd02667, Peptidase_C19K, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19	Back alignment and domain information

>gnl\|CDD\|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239136 cd02671, Peptidase_C19O, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239129 cd02664, Peptidase_C19H, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>gnl\|CDD\|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19	Back alignment and domain information

>gnl\|CDD\|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19	Back alignment and domain information

>gnl\|CDD\|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>gnl\|CDD\|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239138 cd02673, Peptidase_C19Q, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|214563 smart00213, UBQ, Ubiquitin homologues	Back alignment and domain information

>gnl\|CDD\|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239136 cd02671, Peptidase_C19O, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239136 cd02671, Peptidase_C19O, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239128 cd02663, Peptidase_C19G, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239131 cd02666, Peptidase_C19J, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239131 cd02666, Peptidase_C19J, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|227820 COG5533, UBP5, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|239127 cd02662, Peptidase_C19F, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239127 cd02662, Peptidase_C19F, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239132 cd02667, Peptidase_C19K, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239129 cd02664, Peptidase_C19H, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|227409 COG5077, COG5077, Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1	Back alignment and domain information

>gnl\|CDD\|239134 cd02669, Peptidase_C19M, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239127 cd02662, Peptidase_C19F, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239130 cd02665, Peptidase_C19I, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239131 cd02666, Peptidase_C19J, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|239128 cd02663, Peptidase_C19G, A subfamily of Peptidase C19	Back alignment and domain information

>gnl\|CDD\|176364 cd01769, UBL, Ubiquitin-like domain of UBL	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		577
KOG1872\|consensus		473		100.0
cd02657		305	Peptidase_C19A A subfamily of Peptidase C19. Pepti	100.0
KOG1865\|consensus		545		100.0
cd02663		300	Peptidase_C19G A subfamily of Peptidase C19. Pepti	100.0
cd02668		324	Peptidase_C19L A subfamily of Peptidase C19. Pepti	100.0
cd02664		327	Peptidase_C19H A subfamily of Peptidase C19. Pepti	100.0
cd02660		328	Peptidase_C19D A subfamily of Peptidase C19. Pepti	100.0
cd02671		332	Peptidase_C19O A subfamily of Peptidase C19. Pepti	100.0
cd02658		311	Peptidase_C19B A subfamily of Peptidase C19. Pepti	100.0
cd02661		304	Peptidase_C19E A subfamily of Peptidase C19. Pepti	100.0
cd02669		440	Peptidase_C19M A subfamily of Peptidase C19. Pepti	100.0
cd02659		334	peptidase_C19C A subfamily of Peptidase C19. Pepti	100.0
cd02667		279	Peptidase_C19K A subfamily of Peptidase C19. Pepti	100.0
cd02666		343	Peptidase_C19J A subfamily of Peptidase C19. Pepti	100.0
KOG1866\|consensus		944		100.0
cd02662		240	Peptidase_C19F A subfamily of Peptidase C19. Pepti	100.0
COG5560		823	UBP12 Ubiquitin C-terminal hydrolase [Posttranslat	100.0
KOG0944\|consensus		763		100.0
COG5533		415	UBP5 Ubiquitin C-terminal hydrolase [Posttranslati	100.0
COG5077		1089	Ubiquitin carboxyl-terminal hydrolase [Posttransla	100.0
cd02665		228	Peptidase_C19I A subfamily of Peptidase C19. Pepti	100.0
PF00443		269	UCH: Ubiquitin carboxyl-terminal hydrolase; InterP	100.0
KOG1868\|consensus		653		100.0
KOG1867\|consensus		492		100.0
cd02674		230	Peptidase_C19R A subfamily of peptidase C19. Pepti	100.0
cd02673		245	Peptidase_C19Q A subfamily of Peptidase C19. Pepti	100.0
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	100.0
cd02257		255	Peptidase_C19 Peptidase C19 contains ubiquitinyl h	100.0
KOG1863\|consensus		1093		100.0
KOG1864\|consensus		587		100.0
KOG1873\|consensus		877		100.0
KOG4598\|consensus		1203		100.0
PF13423		295	UCH_1: Ubiquitin carboxyl-terminal hydrolase	100.0
cd02672		268	Peptidase_C19P A subfamily of Peptidase C19. Pepti	100.0
KOG1870\|consensus		842		99.97
cd02670		241	Peptidase_C19N A subfamily of Peptidase C19. Pepti	99.97
KOG1871\|consensus		420		99.96
KOG2026\|consensus		442		99.86
cd01813		74	UBP_N UBP ubiquitin processing protease. The UBP (	99.84
KOG1275\|consensus		1118		99.74
cd01812		71	BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter	99.67
cd01791		73	Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know	99.65
cd01807		74	GDX_N ubiquitin-like domain of GDX. GDX contains a	99.59
cd01805		77	RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo	99.57
cd01793		74	Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui	99.56
cd01804		78	midnolin_N Ubiquitin-like domain of midnolin. midn	99.55
cd01797		78	NIRF_N amino-terminal ubiquitin-like domain of Np9	99.54
cd01794		70	DC_UbP_C dendritic cell derived ubiquitin-like pro	99.53
cd01809		72	Scythe_N Ubiquitin-like domain of Scythe protein.	99.52
cd01792		80	ISG15_repeat1 ISG15 ubiquitin-like protein, first	99.51
cd01790		79	Herp_N Homocysteine-responsive endoplasmic reticul	99.5
cd01802		103	AN1_N ubiquitin-like domain of AN1. AN1 (also know	99.5
cd01808		71	hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC	99.47
cd01810		74	ISG15_repeat2 ISG15 ubiquitin-like protein, second	99.47
cd01800		76	SF3a120_C Ubiquitin-like domain of Mammalian splic	99.47
cd01798		70	parkin_N amino-terminal ubiquitin-like of parkin p	99.47
PTZ00044		76	ubiquitin; Provisional	99.46
PF00240		69	ubiquitin: Ubiquitin family; InterPro: IPR000626 U	99.45
cd01796		71	DDI1_N DNA damage inducible protein 1 ubiquitin-li	99.44
cd01806		76	Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn	99.44
cd01803		76	Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40	99.43
KOG0005\|consensus		70		99.41
smart00213		64	UBQ Ubiquitin homologues. Ubiquitin-mediated prote	99.35
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	99.32
cd01815		75	BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC	99.29
KOG0010\|consensus		493		99.27
cd01799		75	Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO	99.21
cd01769		69	UBL Ubiquitin-like domain of UBL. UBLs function by	99.19
KOG0011\|consensus		340		99.19
cd01795		107	USP48_C USP ubiquitin-specific protease. The USP (	99.13
cd01763		87	Sumo Small ubiquitin-related modifier (SUMO). Smal	99.09
KOG0003\|consensus		128		99.09
KOG0004\|consensus		156		99.01
cd01814		113	NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT	98.96
cd01789		84	Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol	98.95
PF15499		275	Peptidase_C98: Ubiquitin-specific peptidase-like,	98.9
PF14560		87	Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K	98.78
PF11976		72	Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter	98.69
cd02666		343	Peptidase_C19J A subfamily of Peptidase C19. Pepti	98.61
cd01801		77	Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N-	98.57
PLN02560		308	enoyl-CoA reductase	98.47
COG5560		823	UBP12 Ubiquitin C-terminal hydrolase [Posttranslat	98.42
cd02658		311	Peptidase_C19B A subfamily of Peptidase C19. Pepti	98.37
PF11543		80	UN_NPL4: Nuclear pore localisation protein NPL4; I	98.36
cd02657		305	Peptidase_C19A A subfamily of Peptidase C19. Pepti	98.27
KOG1873\|consensus		877		98.24
cd01788		119	ElonginB Ubiquitin-like domain of Elongin B. Elong	98.19
cd02669		440	Peptidase_C19M A subfamily of Peptidase C19. Pepti	98.14
cd02661		304	Peptidase_C19E A subfamily of Peptidase C19. Pepti	98.12
cd02660		328	Peptidase_C19D A subfamily of Peptidase C19. Pepti	98.09
cd02664		327	Peptidase_C19H A subfamily of Peptidase C19. Pepti	98.08
KOG4248\|consensus		1143		98.07
COG5533		415	UBP5 Ubiquitin C-terminal hydrolase [Posttranslati	98.06
cd02671		332	Peptidase_C19O A subfamily of Peptidase C19. Pepti	98.02
PF00443		269	UCH: Ubiquitin carboxyl-terminal hydrolase; InterP	98.01
KOG0944\|consensus		763		98.01
KOG1865\|consensus		545		98.01
cd02668		324	Peptidase_C19L A subfamily of Peptidase C19. Pepti	97.98
cd02659		334	peptidase_C19C A subfamily of Peptidase C19. Pepti	97.94
KOG0001\|consensus		75		97.93
cd02667		279	Peptidase_C19K A subfamily of Peptidase C19. Pepti	97.92
cd00196		69	UBQ Ubiquitin-like proteins. Ubiquitin homologs; I	97.88
PF13881		111	Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB	97.79
cd02662		240	Peptidase_C19F A subfamily of Peptidase C19. Pepti	97.79
KOG3493\|consensus		73		97.52
cd01811		80	OASL_repeat1 2'-5' oligoadenylate synthetase-like	97.38
KOG0006\|consensus		446		97.38
KOG3206\|consensus		234		97.37
cd02663		300	Peptidase_C19G A subfamily of Peptidase C19. Pepti	97.34
KOG1863\|consensus		1093		97.28
KOG1871\|consensus		420		97.08
PF08817		79	YukD: WXG100 protein secretion system (Wss), prote	96.92
KOG1868\|consensus		653		96.91
KOG1864\|consensus		587		96.85
KOG1872\|consensus		473		96.72
KOG4495\|consensus		110		96.68
KOG1887\|consensus		806		96.4
PF11470		65	TUG-UBL1: GLUT4 regulating protein TUG; InterPro:	96.29
COG5417		81	Uncharacterized small protein [Function unknown]	96.1
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	95.93
PF10302		97	DUF2407: DUF2407 ubiquitin-like domain; InterPro:	95.87
PF13423		295	UCH_1: Ubiquitin carboxyl-terminal hydrolase	95.76
KOG1639\|consensus		297		95.24
cd02674		230	Peptidase_C19R A subfamily of peptidase C19. Pepti	95.16
KOG1769\|consensus		99		94.94
COG5077		1089	Ubiquitin carboxyl-terminal hydrolase [Posttransla	94.69
KOG1870\|consensus		842		94.52
PF00789		82	UBX: UBX domain; InterPro: IPR001012 The UBX domai	94.31
cd02672		268	Peptidase_C19P A subfamily of Peptidase C19. Pepti	94.16
cd02257		255	Peptidase_C19 Peptidase C19 contains ubiquitinyl h	93.82
smart00166		80	UBX Domain present in ubiquitin-regulatory protein	93.39
PF05408		193	Peptidase_C28: Foot-and-mouth virus L-proteinase;	92.93
KOG0013\|consensus		231		92.78
PF08715		320	Viral_protease: Papain like viral protease; InterP	92.34
cd01770		79	p47_UBX p47-like ubiquitin domain. p47_UBX p47 is	91.96
cd01767		77	UBX UBX (ubiquitin regulatory X) domain. The UBX (	91.25
cd01773		82	Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i	90.92
smart00666		81	PB1 PB1 domain. Phox and Bem1p domain, present in	90.88
KOG1867\|consensus		492		90.49
PRK06437		67	hypothetical protein; Provisional	90.0
PRK08364		70	sulfur carrier protein ThiS; Provisional	89.9
cd06406		80	PB1_P67 A PB1 domain is present in p67 proteins wh	89.87
cd01772		79	SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst	89.82
cd01771		80	Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac	89.75
PF00564		84	PB1: PB1 domain; InterPro: IPR000270 The Phox and	89.36
cd01774		85	Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i	89.27
PF14836		88	Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A	87.52
PRK06488		65	sulfur carrier protein ThiS; Validated	87.51
PF15044		76	CLU_N: Mitochondrial function, CLU-N-term	86.79
cd06407		82	PB1_NLP A PB1 domain is present in NIN like protei	86.19
PF13019		162	Telomere_Sde2: Telomere stability and silencing	86.02
KOG0012\|consensus		380		85.25
PRK06083		84	sulfur carrier protein ThiS; Provisional	84.84
cd00565		65	ThiS ThiaminS ubiquitin-like sulfur carrier protei	84.67
KOG4583\|consensus		391		83.91
PF12754		309	Blt1: Cell-cycle control medial ring component; In	83.55
cd05992		81	PB1 The PB1 domain is a modular domain mediating s	83.08
KOG1866\|consensus		944		83.08
PF05408		193	Peptidase_C28: Foot-and-mouth virus L-proteinase;	81.02
TIGR01683		64	thiS thiamine biosynthesis protein ThiS. This mode	80.54
PLN02799		82	Molybdopterin synthase sulfur carrier subunit	80.44
PRK05863		65	sulfur carrier protein ThiS; Provisional	80.21
cd06408		86	PB1_NoxR The PB1 domain is present in the Epichloe	80.04

>KOG1872\|consensus	Back alignment and domain information

Probab=100.00  E-value=6.2e-77  Score=585.01  Aligned_cols=454  Identities=40%  Similarity=0.624  Sum_probs=395.3

Q ss_pred             EEEEEEeCCeEEEEE-eCCCCCHHHHHHHHHHHhCCCCCCceEEecCCccCCc-cccccccCCCceEEEeccccCCCCCC
Q psy7711          12 YIVKVKWGKETFEVD-VDTDEEPMLFKAQLYELTGVQIDRQKVMCKGATLKND-EWDNFKLSNGSMVLLMGSKEEDSMKE   89 (577)
Q Consensus        12 ~~i~vk~~~~~~~~~-v~~~~tv~~lk~~i~~~~~v~~~~qkl~~~g~~l~d~-~l~~~~~~~~~~i~l~gs~~~~~~~~   89 (577)
                      ..|.|||+|+.|+++ ++.++|+.+||++|+.+|||||+|||+|++|+.++|| .|..++||+|.|||||||+++ .+.+
T Consensus         4 ~~v~VKW~gk~y~v~~l~~d~t~~vlKaqlf~LTgV~PeRQKv~vKGg~a~dd~~~~al~iKpn~~lmMmGt~e~-~~e~   82 (473)
T KOG1872|consen    4 DTVIVKWGGKKYPVETLSTDETPSVLKAQLFALTGVPPERQKVMVKGGLAKDDVDWGALQIKPNETLMMMGTAEA-GLEP   82 (473)
T ss_pred             ceEeeeecCccccceeccCCCchHHHHHHHHHhcCCCccceeEEEecccccccccccccccCCCCEEEeeccccc-cccC
Confidence            449999999999987 9999999999999999999999999999999999999 999999999999999999999 8888


Q ss_pred             ccccccccccchhhHhhhcCCCCcccccCCCCcchhhHHHhhcCCHHHHHHHHhhhCCCCCCCCchhHHHHHHHHHhhhc
Q psy7711          90 PVVKPKFVEDMNESERAVSLDLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECM  169 (577)
Q Consensus        90 ~~~~~~~~ed~~~~~~~~~~~~~~gl~n~g~~cy~ns~~q~l~~~p~l~~~~~~~~~~~~~~~~p~~~~~~~l~~l~~~~  169 (577)
                      |..+..|++|+++++.+....+|+|+.|+|||||||+++||+..+|+|+.++..+.......                  
T Consensus        83 p~~~~~~~ed~~e~~~~~~~~lp~gl~nlgNtcymnrtVq~lk~v~el~~~~s~~~~~~~~~------------------  144 (473)
T KOG1872|consen   83 PSLPPTFIEDSAEQFASAALPLPVGLPNLGNTCYMNRTVQCLKGVPELPDALSLYKRKRGRG------------------  144 (473)
T ss_pred             cccCCcchhhhhHHHHHhhccCCccccchhHHHHhhhhhhhhhcCccCcchhhccchhccCC------------------
Confidence            99999999999988888889999999999999999999999999999998887665322110                  


Q ss_pred             ccCCCCCCCCchhhhcccccccccCCCCCchhHHHHHHHhhccHHHHHHHHhhcCCCCCCCCChhhHHHHHHHHHHHHhc
Q psy7711         170 DNMKISPSISPFIMLQGRYLPAGLNNLGNTCYMNAVIQCLKTVPELRKALKNLKGGLQPGSNPAQSITASLRDLYECMDN  249 (577)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~GL~N~GNtCY~NSvLQ~L~~~~~f~~~l~~~~~~~~~~~~~~~~l~~~L~~Lf~~l~~  249 (577)
                                                                                ........+..+++.+|..|..
T Consensus       145 ----------------------------------------------------------~t~~~a~~i~~~mR~~f~~~~~  166 (473)
T KOG1872|consen  145 ----------------------------------------------------------DTWERRRRISIETRTCFRPLCE  166 (473)
T ss_pred             ----------------------------------------------------------chhhhhhhHHHHHHHHHHhhhc
Confidence                                                                      0001145688899999999998


Q ss_pred             CCCCCCCChHHHHHHHHhhCCccccccCCCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCCCCCccchhhhccceEEeEEE
Q psy7711         250 MKISPSISPFIMLQVLHNVFPRFADKTDDGSYMQQDANECWTEMVRMLKTALPGENEEGQDSAKSSFIEQYFYTIMDTEL  329 (577)
Q Consensus       250 ~~~~~~i~P~~~~~~l~~~~~~f~~~~~~~~~~QqDA~Efl~~ll~~L~~~~~~~~~~~~~~~~~~~i~~lF~g~~~~~~  329 (577)
                      +   +.+.|..+++.+++.+|+|.+....|.+.||||.|++..++-.+++.+.......   .....++.+|++.+..+.
T Consensus       167 ~---~~v~pi~llqtl~~~~Pqfa~~~~~g~~~qqda~ec~~~~m~~l~~~~~~~~~~~---~~~~~~d~~f~~~~~~t~  240 (473)
T KOG1872|consen  167 K---GAVAPINLLQTLSSQYPQFAEWVEYGIYMQQDAAECWMEEPGMLTEALTVATEAP---CLEAEAAAGFGAEFSTTM  240 (473)
T ss_pred             c---CCcchHHHHHHHHHHhHHHHHHhhhhhHHHHHHhHhHHHhhhheecccccccccc---chhHHHHHhhccccccce
Confidence            5   6899999999999999999987777889999999999999999999877654322   445678999999999999


Q ss_pred             EcCCCCCCCCCcccccceeeeeccCCCccchhHHHhhhhhhhhhccCcCCCCCceEEEEEEeccCCCceEEEEEEEEEec
Q psy7711         330 KCSESETEPPTKGTESFQQLSCYITTDVKYMLPGLKNKLQDQITKRSPSLDRDAVYVKTSKVSRLPAYLTIQFVRFFYKE  409 (577)
Q Consensus       330 ~C~~c~~~~~s~~~e~f~~L~l~i~~~~~~l~~~l~~~~~e~i~~~c~~c~~~~~~~k~~~i~~lP~~L~i~l~Rf~~~~  409 (577)
                      .|...+.+......|.|+.|.|.|...+..+..+|+..++|++.+.++..|+++.|.|...|.+||.||+|++.||+|+.
T Consensus       241 ~~~e~e~~~~~~~~E~~~~L~c~i~~~~~~~k~Gl~~~~~e~~~K~s~~lgr~a~y~k~~~isrlP~ylTvq~vrf~~k~  320 (473)
T KOG1872|consen  241 SCSEGEDEGGGAGRELVDQLKCIINKTVHDMRFGLKSGLSEEIQKISSILGRPAAYQKVMYISRLPEYLTVQEVRFFSKA  320 (473)
T ss_pred             eeccCcccccccccccccccceEEeeeechhhhhhhhhhhhhhhccCcccCCChHHHHHhHhhcCcccceEEEEEEEecc
Confidence            99988876555558999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccccCCccccccccCCHHHHhccccchHHHHHHHHHHHHHHHhhhhcccCCCchhhhhhhcccccCCcccc
Q psy7711         410 KERINAKVLKDIKFPIEFDAYELCTPELQAKLAPMREKFKIAEEKEAFEEFRTQYVFISIPMDEIYVRFGQKIYAPVGDR  489 (577)
Q Consensus       410 ~~~~~~Ki~~~V~fp~~Ldl~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~  489 (577)
                      ..++..||.+.|.||..||..++|++++++++.+.|+++++.+++..+.....+.........+.  .     .++    
T Consensus       321 k~~~~akil~~V~fP~~ld~~d~ct~el~~k~~~~r~k~r~~edkk~~~~~~~k~~~~~~~~~~~--~-----~e~----  389 (473)
T KOG1872|consen  321 KIMVVAKILNAVNFPKDLDQQDLCTPELKKKLLCRRKKHRKVEDKKKEEDVMPKVKGAQERLKEV--P-----LEG----  389 (473)
T ss_pred             ccchHHHHHHhccChhhhhHHHhhCHHhhcCccchHHHHHHHHhcCCchhhcccccCcCcccccc--c-----ccc----
Confidence            99999999999999999999999999999999999999999998877666533222111111110  0     000    


Q ss_pred             ccccccccchhcccCCCCCCCCCCCCCCCceeEEEeEEEEeecCCCCCCceEEEEECCCCcEEEEeCCcceecChhhhhc
Q psy7711         490 IQDFGVKSTEFQSRGQGSSPGRVDIGSNNSGYYTLQAVLTHKGRTSSSGHYVAWVKKPNGTWIKCDDDKVYPISEEEVLK  569 (577)
Q Consensus       490 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~L~aVI~H~G~s~~~GHY~a~vr~~~~~W~~~nD~~V~~v~~~~V~~  569 (577)
                                        ..-.++.+++.++.|.|+|||+|.|+|..+|||++|+|...+.|++|||+.|+.+..++|++
T Consensus       390 ------------------~~~~~~~~s~~~g~y~l~~vithkgrss~sghy~aw~r~s~~~w~~fdd~~vs~v~~e~i~~  451 (473)
T KOG1872|consen  390 ------------------MYNKSGGKSRNSGLYDLQLVITHKGRSSKSGHYVAWNRVSEDKWGHFDDDMVSFVLGETILS  451 (473)
T ss_pred             ------------------hhccccccccccceeeeeEeeeccccccCCCcceEEEeccCCceeeccccccccccccceee
Confidence                              00023334445889999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCC
Q psy7711         570 LSGGGKVI  577 (577)
Q Consensus       570 ~~~Gg~~~  577 (577)
                      ++|||||+
T Consensus       452 lsgggd~~  459 (473)
T KOG1872|consen  452 LSGGGDWH  459 (473)
T ss_pred             ecCCCccc
Confidence            99999995

>cd02657 Peptidase_C19A A subfamily of Peptidase C19	Back alignment and domain information

>KOG1865\|consensus	Back alignment and domain information

>cd02663 Peptidase_C19G A subfamily of Peptidase C19	Back alignment and domain information

>cd02668 Peptidase_C19L A subfamily of Peptidase C19	Back alignment and domain information

>cd02664 Peptidase_C19H A subfamily of Peptidase C19	Back alignment and domain information

>cd02660 Peptidase_C19D A subfamily of Peptidase C19	Back alignment and domain information

>cd02671 Peptidase_C19O A subfamily of Peptidase C19	Back alignment and domain information

>cd02658 Peptidase_C19B A subfamily of Peptidase C19	Back alignment and domain information

>cd02661 Peptidase_C19E A subfamily of Peptidase C19	Back alignment and domain information

>cd02669 Peptidase_C19M A subfamily of Peptidase C19	Back alignment and domain information

>cd02659 peptidase_C19C A subfamily of Peptidase C19	Back alignment and domain information

>cd02667 Peptidase_C19K A subfamily of Peptidase C19	Back alignment and domain information

>cd02666 Peptidase_C19J A subfamily of Peptidase C19	Back alignment and domain information

>KOG1866\|consensus	Back alignment and domain information

>cd02662 Peptidase_C19F A subfamily of Peptidase C19	Back alignment and domain information

>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0944\|consensus	Back alignment and domain information

>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02665 Peptidase_C19I A subfamily of Peptidase C19	Back alignment and domain information

>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1868\|consensus	Back alignment and domain information

>KOG1867\|consensus	Back alignment and domain information

>cd02674 Peptidase_C19R A subfamily of peptidase C19	Back alignment and domain information

>cd02673 Peptidase_C19Q A subfamily of Peptidase C19	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>KOG1863\|consensus	Back alignment and domain information

>KOG1864\|consensus	Back alignment and domain information

>KOG1873\|consensus	Back alignment and domain information

>KOG4598\|consensus	Back alignment and domain information

>PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase	Back alignment and domain information

>cd02672 Peptidase_C19P A subfamily of Peptidase C19	Back alignment and domain information

>KOG1870\|consensus	Back alignment and domain information

>cd02670 Peptidase_C19N A subfamily of Peptidase C19	Back alignment and domain information

>KOG1871\|consensus	Back alignment and domain information

>KOG2026\|consensus	Back alignment and domain information

>cd01813 UBP_N UBP ubiquitin processing protease	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>cd01812 BAG1_N Ubiquitin-like domain of BAG1	Back alignment and domain information

>cd01791 Ubl5 UBL5 ubiquitin-like modifier	Back alignment and domain information

>cd01807 GDX_N ubiquitin-like domain of GDX	Back alignment and domain information

>cd01805 RAD23_N Ubiquitin-like domain of RAD23	Back alignment and domain information

>cd01793 Fubi Fubi ubiquitin-like protein	Back alignment and domain information

>cd01804 midnolin_N Ubiquitin-like domain of midnolin	Back alignment and domain information

>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF	Back alignment and domain information

>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein	Back alignment and domain information

>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein	Back alignment and domain information

>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2	Back alignment and domain information

>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein	Back alignment and domain information

>cd01802 AN1_N ubiquitin-like domain of AN1	Back alignment and domain information

>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2	Back alignment and domain information

>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2	Back alignment and domain information

>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120	Back alignment and domain information

>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein	Back alignment and domain information

>PTZ00044 ubiquitin; Provisional	Back alignment and domain information

>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade	Back alignment and domain information

>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain	Back alignment and domain information

>cd01806 Nedd8 Nebb8-like ubiquitin protein	Back alignment and domain information

>cd01803 Ubiquitin Ubiquitin	Back alignment and domain information

>KOG0005\|consensus	Back alignment and domain information

>smart00213 UBQ Ubiquitin homologues	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP	Back alignment and domain information

>KOG0010\|consensus	Back alignment and domain information

>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1	Back alignment and domain information

>cd01769 UBL Ubiquitin-like domain of UBL	Back alignment and domain information

>KOG0011\|consensus	Back alignment and domain information

>cd01795 USP48_C USP ubiquitin-specific protease	Back alignment and domain information

>cd01763 Sumo Small ubiquitin-related modifier (SUMO)	Back alignment and domain information

>KOG0003\|consensus	Back alignment and domain information

>KOG0004\|consensus	Back alignment and domain information

>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4	Back alignment and domain information

>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B	Back alignment and domain information

>PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase	Back alignment and domain information

>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A	Back alignment and domain information

>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins	Back alignment and domain information

>cd02666 Peptidase_C19J A subfamily of Peptidase C19	Back alignment and domain information

>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13	Back alignment and domain information

>PLN02560 enoyl-CoA reductase	Back alignment and domain information

>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02658 Peptidase_C19B A subfamily of Peptidase C19	Back alignment and domain information

>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway	Back alignment and domain information

>cd02657 Peptidase_C19A A subfamily of Peptidase C19	Back alignment and domain information

>KOG1873\|consensus	Back alignment and domain information

>cd01788 ElonginB Ubiquitin-like domain of Elongin B	Back alignment and domain information

>cd02669 Peptidase_C19M A subfamily of Peptidase C19	Back alignment and domain information

>cd02661 Peptidase_C19E A subfamily of Peptidase C19	Back alignment and domain information

>cd02660 Peptidase_C19D A subfamily of Peptidase C19	Back alignment and domain information

>cd02664 Peptidase_C19H A subfamily of Peptidase C19	Back alignment and domain information

>KOG4248\|consensus	Back alignment and domain information

>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02671 Peptidase_C19O A subfamily of Peptidase C19	Back alignment and domain information

>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0944\|consensus	Back alignment and domain information

>KOG1865\|consensus	Back alignment and domain information

>cd02668 Peptidase_C19L A subfamily of Peptidase C19	Back alignment and domain information

>cd02659 peptidase_C19C A subfamily of Peptidase C19	Back alignment and domain information

>KOG0001\|consensus	Back alignment and domain information

>cd02667 Peptidase_C19K A subfamily of Peptidase C19	Back alignment and domain information

>cd00196 UBQ Ubiquitin-like proteins	Back alignment and domain information

>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A	Back alignment and domain information

>cd02662 Peptidase_C19F A subfamily of Peptidase C19	Back alignment and domain information

>KOG3493\|consensus	Back alignment and domain information

>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2	Back alignment and domain information

>KOG0006\|consensus	Back alignment and domain information

>KOG3206\|consensus	Back alignment and domain information

>cd02663 Peptidase_C19G A subfamily of Peptidase C19	Back alignment and domain information

>KOG1863\|consensus	Back alignment and domain information

>KOG1871\|consensus	Back alignment and domain information

>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []	Back alignment and domain information

>KOG1868\|consensus	Back alignment and domain information

>KOG1864\|consensus	Back alignment and domain information

>KOG1872\|consensus	Back alignment and domain information

>KOG4495\|consensus	Back alignment and domain information

>KOG1887\|consensus	Back alignment and domain information

>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly	Back alignment and domain information

>COG5417 Uncharacterized small protein [Function unknown]	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi	Back alignment and domain information

>PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase	Back alignment and domain information

>KOG1639\|consensus	Back alignment and domain information

>cd02674 Peptidase_C19R A subfamily of peptidase C19	Back alignment and domain information

>KOG1769\|consensus	Back alignment and domain information

>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1870\|consensus	Back alignment and domain information

>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast	Back alignment and domain information

>cd02672 Peptidase_C19P A subfamily of Peptidase C19	Back alignment and domain information

>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>smart00166 UBX Domain present in ubiquitin-regulatory proteins	Back alignment and domain information

>PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0013\|consensus	Back alignment and domain information

>PF08715 Viral_protease: Papain like viral protease; InterPro: IPR014827 This family of viral proteases are similar to the papain protease and are required for proteolytic processing of the replicase polyprotein	Back alignment and domain information

>cd01770 p47_UBX p47-like ubiquitin domain	Back alignment and domain information

>cd01767 UBX UBX (ubiquitin regulatory X) domain	Back alignment and domain information

>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain	Back alignment and domain information

>smart00666 PB1 PB1 domain	Back alignment and domain information

>KOG1867\|consensus	Back alignment and domain information

>PRK06437 hypothetical protein; Provisional	Back alignment and domain information

>PRK08364 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis	Back alignment and domain information

>cd01772 SAKS1_UBX SAKS1-like UBX domain	Back alignment and domain information

>cd01771 Faf1_UBX Faf1 UBX domain	Back alignment and domain information

>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins	Back alignment and domain information

>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain	Back alignment and domain information

>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A	Back alignment and domain information

>PRK06488 sulfur carrier protein ThiS; Validated	Back alignment and domain information

>PF15044 CLU_N: Mitochondrial function, CLU-N-term	Back alignment and domain information

>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium)	Back alignment and domain information

>PF13019 Telomere_Sde2: Telomere stability and silencing	Back alignment and domain information

>KOG0012\|consensus	Back alignment and domain information

>PRK06083 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein	Back alignment and domain information

>KOG4583\|consensus	Back alignment and domain information

>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures	Back alignment and domain information

>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity	Back alignment and domain information

>KOG1866\|consensus	Back alignment and domain information

>PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>TIGR01683 thiS thiamine biosynthesis protein ThiS	Back alignment and domain information

>PLN02799 Molybdopterin synthase sulfur carrier subunit	Back alignment and domain information

>PRK05863 sulfur carrier protein ThiS; Provisional	Back alignment and domain information

>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		577
2ayn_A		404	Structure Of Usp14, A Proteasome-Associated Deubiqu		1e-104
1vjv_A		415	Crystal Structure Of Ubiquitin Carboxyl-terminal Hy		3e-31
1vjv_A		415	Crystal Structure Of Ubiquitin Carboxyl-terminal Hy		6e-08
1wgg_A		96	Solution Structure Of The N-Terminal Ubiquitin-Like		3e-14
2hd5_A		359	Usp2 In Complex With Ubiquitin Length = 359		2e-07
3v6c_A		367	Crystal Structure Of Usp2 In Complex With Mutated U		3e-07
2ibi_A		374	Covalent Ubiquitin-Usp2 Complex Length = 374		3e-07
3i3t_A		355	Crystal Structure Of Covalent Ubiquitin-usp21 Compl		3e-07
3mtn_A		373	Usp21 In Complex With A Ubiquitin-based, Usp21-spec		3e-07
2y5b_A		370	Structure Of Usp21 In Complex With Linear Diubiquit		3e-07
3nhe_A		348	High Resolution Structure (1.26a) Of Usp2a In Compl		4e-06
3ihp_A		854	Covalent Ubiquitin-Usp5 Complex Length = 854		9e-06
4fip_A		476	Structure Of The Saga Ubp8(S144n)SGF11(1-72, Delta-		1e-05
3m99_A		471	Structure Of The Ubp8-Sgf11-Sgf73-Sus1 Saga Dub Mod		1e-05
3mhh_A		476	Structure Of The Saga Ubp8SGF11SUS1SGF73 DUB MODULE		1e-05
1nbf_A		353	Crystal Structure Of A Ubp-Family Deubiquitinating		2e-04
1nb8_A		353	Structure Of The Catalytic Domain Of Usp7 (Hausp) L		2e-04
2f1z_A		522	Crystal Structure Of Hausp Length = 522		3e-04
3n3k_A		396	The Catalytic Domain Of Usp8 In Complex With A Usp8		4e-04

>pdb|2AYN|A Chain A, Structure Of Usp14, A Proteasome-Associated Deubiquitinating Enzyme Length = 404