Diaphorina citri psyllid: psy7717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MSEEITDNTPEGSAPSSPSIGAEAKVKVPILLRATGDAPILTKKKWLVHVDQNVASIISFTKKSIKMDPSESLFIYVNQSFAPSPDTTIRALYDSFATNGSLVLNYCKTQAWG
cccccccccccccccccccccccccccEEEEEEEccccccccccEEEEEccccHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHcccccEEEEEEccccccc
************************KVKVPILLRATGDAPILTKKKWLVHVDQNVASIISFTKKSIKMDPSESLFIYVNQSFAPSPDTTIRALYDSFATNGSLVLNYCKTQAWG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEEITDNTPEGSAPSSPSIGAEAKVKVPILLRATGDAPILTKKKWLVHVDQNVASIISFTKKSIKMDPSESLFIYVNQSFAPSPDTTIRALYDSFATNGSLVLNYCKTQAWG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy protein 12-like Required for autophagy.confidentQ9VTU1
Ubiquitin-like protein ATG12 Ubiquitin-like protein involved in cytoplasm to vacuole transport (Cvt) and autophagy vesicles formation. Conjugation with ATG5 through an ubiquitin-like conjugating system is essential for its function. ATG12/ATG5 conjugate has an essential role in plant nutrient recycling.confidentQ69NP0
Ubiquitin-like protein atg12 Ubiquitin-like protein involved in autophagy vesicles formation. Required for atg8 association to the vesicle membranes. Conjugated to atg5 through an ubiquitin-like conjugating system involving also atg7 as an E1-like activating enzyme is essential for its function.confidentQ86CR6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034045 [CC]pre-autophagosomal structure membraneprobableGO:0005737, GO:0000407, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0042177 [BP]negative regulation of protein catabolic processprobableGO:0051248, GO:0009895, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0009894, GO:0008150, GO:0042176, GO:0065007, GO:0048519, GO:0009892, GO:0050789
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0071688 [BP]striated muscle myosin thick filament assemblyprobableGO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0051146, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0034622, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030154, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0044763, GO:0009987, GO:0042692
GO:0051117 [MF]ATPase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0019898 [CC]extrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0000149 [MF]SNARE bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0000421 [CC]autophagic vacuole membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0005773, GO:0016020, GO:0044464, GO:0005776, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032781 [BP]positive regulation of ATPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0050789, GO:0043085, GO:0043462, GO:0031329, GO:0051345, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0000045 [BP]autophagic vacuole assemblyprobableGO:0009991, GO:0022607, GO:0008152, GO:0016236, GO:0044248, GO:0042594, GO:0044699, GO:0051716, GO:0016043, GO:0071840, GO:0071496, GO:0006914, GO:0009987, GO:0006950, GO:0044763, GO:0009267, GO:0007154, GO:0070925, GO:0009056, GO:0006996, GO:0007033, GO:0031668, GO:0031669, GO:0009605, GO:0050896, GO:0031667, GO:0044237, GO:0044085, GO:0033554, GO:0008150
GO:0070265 [BP]necrotic cell deathprobableGO:0010259, GO:0009987, GO:0008150, GO:0044763, GO:0007569, GO:0044699
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WZ3, chain A
Confidence level:very confident
Coverage over the Query: 26-112
View the alignment between query and template
View the model in PyMOL