Diaphorina citri psyllid: psy7735


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MGLCDNLLTCILRAWDFSKPILFCPAMNTKMWNHPITKSHINTLKSWGYEEIPCVSKTLMCGDTGLGAMAEVDTIKYGFVPNTIRKSTEPQDPNNFVDNNAGITEYSLTGFLYFSLRDDL
ccccHHHHHHHHHcccccccEEEEccccHHHHHcHHHHHHHHHHHHcccEECcccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccc
MGLCDNLLTCILRAWDFSKPILFCPAMNTKMWNHPITKSHINTLKSWGYEEIPCVSKTLMCGDTGLGAMAEVDTIKYGFVPNTIRKSTEPQDPNNFVDNNAGITEYSLTGFLYFSLRDD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLCDNLLTCILRAWDFSKPILFCPAMNTKMWNHPITKSHINTLKSWGYEEIPCVSKTLMCGDTGLGAMAEVDTIKYGFVPNTIRKSTEPQDPNNFVDNNAGITEYSLTGFLYFSLRDDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphopantothenoylcysteine decarboxylase Necessary for the biosynthesis of coenzyme A. Catalyzes the decarboxylation of 4-phosphopantothenoylcysteine to form 4'-phosphopantotheine.confidentQ8BZB2
Phosphopantothenoylcysteine decarboxylase Necessary for the biosynthesis of coenzyme A. Catalyzes the decarboxylation of 4-phosphopantothenoylcysteine to form 4'-phosphopantotheine.confidentQ96CD2
Putative phosphopantothenoylcysteine decarboxylase Necessary for the biosynthesis of coenzyme A. Catalyzes the decarboxylation of 4-phosphopantothenoylcysteine to form 4'-phosphopantotheine.confidentQ54Y51

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004633 [MF]phosphopantothenoylcysteine decarboxylase activityprobableGO:0003824, GO:0016829, GO:0016830, GO:0016831, GO:0003674
GO:0071513 [CC]phosphopantothenoylcysteine decarboxylase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0015937 [BP]coenzyme A biosynthetic processprobableGO:0055086, GO:0015936, GO:0006732, GO:0033866, GO:0044249, GO:0034641, GO:0009165, GO:0009108, GO:0009163, GO:0072521, GO:0072522, GO:1901362, GO:0042451, GO:1901360, GO:1901576, GO:0044710, GO:0051186, GO:0090407, GO:0042278, GO:0033875, GO:0051188, GO:0009259, GO:0008150, GO:0071704, GO:0034032, GO:0046483, GO:0044281, GO:0018130, GO:0009119, GO:0019693, GO:0006139, GO:0009987, GO:0006725, GO:0009152, GO:0006793, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0046129, GO:0046128, GO:0034030, GO:0042455, GO:0034033, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0044237, GO:0033865, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:1901659
GO:0015939 [BP]pantothenate metabolic processprobableGO:0044238, GO:0006767, GO:0051186, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006732, GO:0006520, GO:0019752, GO:0044710, GO:0044237, GO:0071704, GO:0034641, GO:0006766, GO:0006807, GO:0044281, GO:0008152, GO:0043436, GO:0008150, GO:0009987

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QZU, chain A
Confidence level:very confident
Coverage over the Query: 1-53,72-82
View the alignment between query and template
View the model in PyMOL
Template: 2GK4, chain A
Confidence level:confident
Coverage over the Query: 82-115
View the alignment between query and template
View the model in PyMOL