Diaphorina citri psyllid: psy7774

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSAENESVSGRGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN
cccccHHHHHHHHHHcccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEcccccccEEEEccccccEEEEEEcccccccccccccccEEEEEcccccccccHHHHHHHHHccccEEEEEEEEccc
*RSATYQLAASVLRQCGNSITMLVQYSP**************************************************************RFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSAENESVSGRGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0008150 [BP]biological_processprobable
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XKX, chain A
Confidence level:very confident
Coverage over the Query: 1-30,55,88-172
View the alignment between query and template
View the model in PyMOL