Psyllid ID: psy7774


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSAENESVSGRGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN
cccccHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEccccccEEEEEEcccccccccccccccEEEEEcccccccccHHHHHHHHHccccEEEEEEEEccc
cccHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEEcccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccc
MRSATYQLAASVLRQCGNSitmlvqyspdkyhelegsgsssaenesvsgrgsgsptpcnspgtnrkssiqhntstltrthvckdersgeprfLMIETRKCSNLGISLVGGNAVGIYVHSVqsgslgysaglrtGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSaenesvsgrgsgsptpcnspgtnrkssiqhntstltrthvckdersgEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYelakpadkvtvlahsdtn
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELegsgsssaenesvsgRGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRaataeeaayelaKPADKVTVLAHSDTN
******QLAASVLRQCGNSITMLVQY****************************************************************RFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYE*****************
*RSATYQLAASVLRQCGNSITMLVQYSP****************************************************************LMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSD**
MRSATYQLAASVLRQCGNSITMLVQYSPDKY*************************************IQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN
*RSATYQLAASVLRQCGNSITMLVQYSPD********************************************************RSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSD**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSAENESVSGRGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAHSDTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q8TDM6 1919 Disks large homolog 5 OS= yes N/A 0.878 0.079 0.306 6e-12
Q9UDY2 1190 Tight junction protein ZO no N/A 0.843 0.122 0.325 4e-11
Q9Z0U1 1167 Tight junction protein ZO no N/A 0.843 0.125 0.319 6e-10
Q95168 1174 Tight junction protein ZO no N/A 0.468 0.068 0.397 5e-09
Q5PYH6 873 Disks large homolog 1 OS= no N/A 0.549 0.108 0.367 4e-08
O62683 898 Tight junction protein ZO no N/A 0.699 0.134 0.279 5e-08
Q62936 849 Disks large homolog 3 OS= no N/A 0.612 0.124 0.333 7e-08
Q92796 817 Disks large homolog 3 OS= no N/A 0.612 0.129 0.333 7e-08
P70175 849 Disks large homolog 3 OS= no N/A 0.612 0.124 0.333 7e-08
Q9QXY1 905 Tight junction protein ZO no N/A 0.514 0.098 0.351 9e-08
>sp|Q8TDM6|DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens GN=DLG5 PE=1 SV=4 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 87/189 (46%), Gaps = 37/189 (19%)

Query: 1    MRSATYQLAASVLRQCGNSITMLVQYSPDKYH------------------ELEGSGSSSA 42
            +RSAT Q A  ++ Q  ++IT+L QY+P  +                    L+GSG+++ 
Sbjct: 1402 LRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTP 1461

Query: 43   ENESVSG----RGSGSPTPCNSPGTNRKSSIQHNTSTLTRTHVCKDERSGEPRFLMIETR 98
            E+ SV      +  G  TP   P     S I  +           ++++ EPR + I+  
Sbjct: 1462 EHPSVIDPLMEQDEGPSTP---PAKQSSSRIAGDA----------NKKTLEPRVVFIKKS 1508

Query: 99   KCSNLGISLVGGNAVGIYVHSVQSGSLGYSA-GLRTGDRILEYNGTDLRAATAEEAAYEL 157
            +   LG+ L GGN  G++V  V+  S      GL  GD ILEY   D+R  T EE   E+
Sbjct: 1509 QL-ELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDVRNKTVEEVYVEM 1567

Query: 158  AKPADKVTV 166
             KP D V +
Sbjct: 1568 LKPRDGVRL 1576




May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.
Homo sapiens (taxid: 9606)
>sp|Q9UDY2|ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens GN=TJP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z0U1|ZO2_MOUSE Tight junction protein ZO-2 OS=Mus musculus GN=Tjp2 PE=1 SV=2 Back     alignment and function description
>sp|Q95168|ZO2_CANFA Tight junction protein ZO-2 OS=Canis familiaris GN=TJP2 PE=1 SV=1 Back     alignment and function description
>sp|Q5PYH6|DLG1_DANRE Disks large homolog 1 OS=Danio rerio GN=dlg1 PE=2 SV=2 Back     alignment and function description
>sp|O62683|ZO3_CANFA Tight junction protein ZO-3 OS=Canis familiaris GN=TJP3 PE=1 SV=1 Back     alignment and function description
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q92796|DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens GN=DLG3 PE=1 SV=2 Back     alignment and function description
>sp|P70175|DLG3_MOUSE Disks large homolog 3 OS=Mus musculus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q9QXY1|ZO3_MOUSE Tight junction protein ZO-3 OS=Mus musculus GN=Tjp3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
328718447 1666 PREDICTED: disks large homolog 5-like [A 0.936 0.097 0.691 5e-52
189240193 1757 PREDICTED: similar to AGAP007865-PA [Tri 0.959 0.094 0.643 7e-52
270012301 1645 hypothetical protein TcasGA2_TC006425 [T 0.959 0.100 0.643 8e-52
242009028 1793 discs large protein, putative [Pediculus 0.953 0.092 0.579 2e-49
357610048 2007 putative discs large protein [Danaus ple 0.953 0.082 0.620 3e-46
328716348 1525 PREDICTED: disks large homolog 5-like [A 0.936 0.106 0.606 2e-43
321470311 2026 hypothetical protein DAPPUDRAFT_242543 [ 0.982 0.083 0.411 2e-39
170059255 870 Dlg5 protein [Culex quinquefasciatus] gi 0.924 0.183 0.481 2e-35
241311069 1558 discs large protein, putative [Ixodes sc 0.936 0.103 0.510 9e-35
158297389 1707 AGAP007865-PA [Anopheles gambiae str. PE 0.924 0.093 0.448 5e-34
>gi|328718447|ref|XP_001945500.2| PREDICTED: disks large homolog 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 139/178 (78%), Gaps = 16/178 (8%)

Query: 1    MRSATYQLAASVLRQCGNSITMLVQYSPDKYHELEGSGSSSAENESVSGRGSGSPTPCNS 60
            MRSATYQLAA+VLRQCGNSITMLVQYSPDKY ELEG+ SS++         S +PTPCNS
Sbjct: 1151 MRSATYQLAANVLRQCGNSITMLVQYSPDKYQELEGAESSTSS-------RSETPTPCNS 1203

Query: 61   PGTNRKSS----IQHNTSTLTRTHVCKDE-----RSGEPRFLMIETRKCSNLGISLVGGN 111
            P  NRKS+    I H  +TLTR    ++      R+ EPR+ ++ETRKCSNLGISLVGGN
Sbjct: 1204 PTVNRKSTGASVIAHGMATLTRRKSDRNTDSRSLRAYEPRYFIMETRKCSNLGISLVGGN 1263

Query: 112  AVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLAH 169
            AVGI+VHSV   SL Y+AGLRTGDRILEYNGTDLR ATAEEAAYELAKPA+KVTVLA 
Sbjct: 1264 AVGIFVHSVNLNSLAYNAGLRTGDRILEYNGTDLREATAEEAAYELAKPAEKVTVLAQ 1321




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189240193|ref|XP_975297.2| PREDICTED: similar to AGAP007865-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270012301|gb|EFA08749.1| hypothetical protein TcasGA2_TC006425 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242009028|ref|XP_002425295.1| discs large protein, putative [Pediculus humanus corporis] gi|212509060|gb|EEB12557.1| discs large protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357610048|gb|EHJ66805.1| putative discs large protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|328716348|ref|XP_003245905.1| PREDICTED: disks large homolog 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|321470311|gb|EFX81288.1| hypothetical protein DAPPUDRAFT_242543 [Daphnia pulex] Back     alignment and taxonomy information
>gi|170059255|ref|XP_001865284.1| Dlg5 protein [Culex quinquefasciatus] gi|167878112|gb|EDS41495.1| Dlg5 protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|241311069|ref|XP_002407838.1| discs large protein, putative [Ixodes scapularis] gi|215497232|gb|EEC06726.1| discs large protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|158297389|ref|XP_317627.4| AGAP007865-PA [Anopheles gambiae str. PEST] gi|157015171|gb|EAA12923.4| AGAP007865-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
FB|FBgn0032363 1916 CG6509 [Drosophila melanogaste 0.462 0.041 0.462 1.7e-23
UNIPROTKB|F1NIA7 1830 DLG5 "Uncharacterized protein" 0.647 0.061 0.341 7.1e-09
UNIPROTKB|F6X528 1919 DLG5 "Uncharacterized protein" 0.930 0.083 0.301 7.9e-09
UNIPROTKB|Q8TDM6 1919 DLG5 "Disks large homolog 5" [ 0.936 0.084 0.291 1e-08
UNIPROTKB|E2R2E4 1922 DLG5 "Uncharacterized protein" 0.936 0.084 0.299 6.2e-09
ZFIN|ZDB-GENE-030131-3149 1958 dlg5a "discs, large homolog 5a 0.456 0.040 0.387 2.9e-10
UNIPROTKB|F1MSI9 1922 DLG5 "Uncharacterized protein" 0.682 0.061 0.330 4.8e-09
ZFIN|ZDB-GENE-040718-58 1204 tjp2b "tight junction protein 0.520 0.074 0.358 7.3e-09
FB|FBgn0262614 2090 pyd "polychaetoid" [Drosophila 0.387 0.032 0.405 7.6e-09
UNIPROTKB|D4A319 1904 D4A319 "Uncharacterized protei 0.635 0.057 0.321 7.8e-09
FB|FBgn0032363 CG6509 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 1.7e-23, Sum P(2) = 1.7e-23
 Identities = 37/80 (46%), Positives = 44/80 (55%)

Query:    91 RFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRXXXX 150
             R++ +   K  NLGI L GGN VGIYVH V  GS    AG+R GD+ILEYNG DL     
Sbjct:  1498 RYVTLHMDKSKNLGIKLFGGNKVGIYVHDVAVGSPSDHAGIRKGDQILEYNGVDLSGVTA 1557

Query:   151 XXXXXXXXKPADKVTVLAHS 170
                     K  D VT+L  +
Sbjct:  1558 EQAANEISKLTDTVTMLVQN 1577


GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F1NIA7 DLG5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F6X528 DLG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDM6 DLG5 "Disks large homolog 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2E4 DLG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3149 dlg5a "discs, large homolog 5a (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSI9 DLG5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-58 tjp2b "tight junction protein 2b (zona occludens 2)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0262614 pyd "polychaetoid" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D4A319 D4A319 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 9e-16
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-15
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 3e-13
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-12
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 1e-06
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-06
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 1e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 6e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 4e-04
TIGR02037 428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.001
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 0.001
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 68.0 bits (167), Expect = 9e-16
 Identities = 31/80 (38%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 90  PRFLMIETRKCSNLGISLVGGN--AVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRA 147
            R + +       LG SL GG     GI+V  V+ G      GLR GDRILE NG  +  
Sbjct: 1   VRTVTLRKDPGGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVEG 60

Query: 148 ATAEEAAYELAKPADKVTVL 167
            T EEA   L    D+VT+ 
Sbjct: 61  LTHEEAVELLKNSGDEVTLT 80


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
KOG3209|consensus 984 99.78
KOG3209|consensus984 99.76
KOG3550|consensus207 99.72
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.69
KOG3551|consensus 506 99.49
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.42
KOG3549|consensus 505 99.42
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.4
KOG3580|consensus 1027 99.36
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.34
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.25
KOG3553|consensus124 99.18
KOG3580|consensus 1027 99.15
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.12
KOG1892|consensus 1629 98.97
KOG3606|consensus 358 98.92
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.87
KOG3571|consensus 626 98.86
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.82
KOG3651|consensus 429 98.81
KOG3542|consensus 1283 98.77
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.74
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.74
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.71
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.69
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.66
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.64
KOG3552|consensus 1298 98.61
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.57
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.52
KOG0609|consensus 542 98.49
PRK11186 667 carboxy-terminal protease; Provisional 98.45
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.43
PRK10139 455 serine endoprotease; Provisional 98.31
PRK10898353 serine endoprotease; Provisional 98.29
PRK10942 473 serine endoprotease; Provisional 98.27
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.26
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.26
KOG3605|consensus829 98.24
PRK10139455 serine endoprotease; Provisional 98.18
PRK10942473 serine endoprotease; Provisional 98.12
KOG3605|consensus829 98.12
KOG3938|consensus 334 98.1
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.08
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.04
KOG4371|consensus1332 97.98
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.74
KOG0606|consensus 1205 97.74
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.72
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.67
KOG3129|consensus231 97.62
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.59
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.49
PRK09681276 putative type II secretion protein GspC; Provision 97.19
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.1
KOG3549|consensus 505 97.05
COG3975558 Predicted protease with the C-terminal PDZ domain 96.99
KOG3532|consensus 1051 96.94
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 96.93
KOG3551|consensus 506 96.84
KOG1320|consensus473 96.78
COG3031275 PulC Type II secretory pathway, component PulC [In 96.58
KOG1738|consensus 638 96.42
KOG1421|consensus 955 95.69
KOG4407|consensus 1973 94.2
KOG4371|consensus 1332 92.85
COG0750 375 Predicted membrane-associated Zn-dependent proteas 90.75
KOG3834|consensus 462 90.29
PF1281278 PDZ_1: PDZ-like domain 89.78
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 88.66
KOG3834|consensus 462 87.48
KOG3550|consensus207 87.05
KOG4407|consensus 1973 86.06
KOG0708|consensus 359 84.86
KOG0792|consensus 1144 81.91
>KOG3209|consensus Back     alignment and domain information
Probab=99.78  E-value=1.1e-17  Score=142.16  Aligned_cols=169  Identities=17%  Similarity=0.304  Sum_probs=111.0

Q ss_pred             CCcccHHHHHHHHhhC--CCeEEEEEEeCCCccC-----CCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCC
Q psy7774           1 MRSATYQLAASVLRQC--GNSITMLVQYSPDKYH-----ELEGSGSSSAENESVSGRGSGSPTPCNSPGTNRKSSIQHNT   73 (173)
Q Consensus         1 l~~~th~~av~~L~~~--g~~v~L~V~r~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~   73 (173)
                      +++++|.|||+||++|  |.++.|+|+|......     ..+.+....+.....+.....+..|.. ++ .+....+...
T Consensus       536 vr~L~h~qvvdmlke~piG~r~~Llv~RGgp~s~~ktpk~~~r~~~~~s~~~s~sap~i~q~~Pfp-p~-~rs~~pd~t~  613 (984)
T KOG3209|consen  536 VRALTHTQVVDMLKECPIGSRVHLLVKRGGPPSPSKTPKAADRKENQGSNQMSSSAPLIPQKLPFP-PT-SRSEEPDNTR  613 (984)
T ss_pred             ccccchHHHHHHHHhccCCcceeEEEecCCCCCCCcCcchhhhccCCCCccccccccccCCCCCCC-Cc-ccccCCcccc
Confidence            4789999999999996  8999999998655321     011111111111111111111222211 11 1111111111


Q ss_pred             Ccccc--------------------CCCCCCCCCCCCEEEEEEccCCCcccEEEEccC--CCCEEEEEecCCCcccc-cC
Q psy7774          74 STLTR--------------------THVCKDERSGEPRFLMIETRKCSNLGISLVGGN--AVGIYVHSVQSGSLGYS-AG  130 (173)
Q Consensus        74 ~~~~~--------------------~~~~~~~~~~~~~~v~l~~~~~~~lG~~l~gg~--~~~i~V~~v~~gs~A~~-~g  130 (173)
                      .+++.                    .+..+.+......+|.|+|.. .||||+|.||.  +.+|||..|.+.|+|+. ++
T Consensus       614 ~~~qrkpdp~~~we~Sraiyesr~~Ps~tsn~~pdk~ldV~L~rke-sGFGFRiLGG~ep~qpi~iG~Iv~lGaAe~DGR  692 (984)
T KOG3209|consen  614 NTLQRKPDPTEEWEKSRAIYESRMRPSSTSNQKPDKELDVFLRRKE-SGFGFRILGGDEPGQPIYIGAIVPLGAAEEDGR  692 (984)
T ss_pred             cccccCCChHHHhhhcccchhccCCCCCccccCCccceeEEEEeec-cccceEEecCCCCCCeeEEeeeeecccccccCc
Confidence            11111                    111223333466789999987 89999999998  56899999999999999 55


Q ss_pred             CCCCCEEEEECCEecCCCCHHHHHHHHh--CCCCeEEEEEEECC
Q psy7774         131 LRTGDRILEYNGTDLRAATAEEAAYELA--KPADKVTVLAHSDT  172 (173)
Q Consensus       131 L~~gD~Il~Vng~~~~~~~~~~~~~~l~--~~g~~v~l~v~r~~  172 (173)
                      |+.||.|+.|+|.++++++|.+++.+|.  ...+.|.|+|+|..
T Consensus       693 L~~gDElv~iDG~pV~GksH~~vv~Lm~~AArnghV~LtVRRkv  736 (984)
T KOG3209|consen  693 LREGDELVCIDGIPVEGKSHSEVVDLMEAAARNGHVNLTVRRKV  736 (984)
T ss_pred             ccCCCeEEEecCeeccCccHHHHHHHHHHHHhcCceEEEEeeee
Confidence            9999999999999999999999999995  45789999999864



>KOG3209|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1uit_A117 Solution Structure Of Rsgi Ruh-006, The Third Pdz D 8e-10
3tsw_A 391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 9e-06
3tsw_B 194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 2e-05
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 2e-05
3tsv_A124 Crystal Structure Of The Third Pdz Domain Of The Hu 2e-05
3shu_A95 Crystal Structure Of Zo-1 Pdz3 Length = 95 5e-05
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 7e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 8e-05
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 9e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 1e-04
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 1e-04
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 1e-04
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 2e-04
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 2e-04
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 2e-04
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 2e-04
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 4e-04
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 6e-04
>pdb|1UIT|A Chain A, Solution Structure Of Rsgi Ruh-006, The Third Pdz Domain Of Hdlg5 (Kiaa0583) Protein [homo Sapiens] Length = 117 Back     alignment and structure

Iteration: 1

Score = 59.7 bits (143), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Query: 89 EPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRXX 148 EPR + ++ + LGIS+V G GIYV V GS+ + AGL GD++LE+NG +LR Sbjct: 19 EPRHVKVQ-KGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGINLRSA 77 Query: 149 XXXXXXXXXXKPADKVTVLAH 169 + D +T+LA Sbjct: 78 TEQQARLIIGQQCDTITILAQ 98
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure
>pdb|3TSV|A Chain A, Crystal Structure Of The Third Pdz Domain Of The Human Zo-1 Maguk Protein Length = 124 Back     alignment and structure
>pdb|3SHU|A Chain A, Crystal Structure Of Zo-1 Pdz3 Length = 95 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 8e-27
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-22
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-21
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-13
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-04
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-20
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 8e-20
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-07
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-18
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 5e-18
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-08
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 4e-17
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-08
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-16
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-06
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-16
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 5e-16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-15
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-15
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-15
2eei_A106 PDZ domain-containing protein 1; regulatory factor 8e-15
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-14
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 5e-09
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-13
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-13
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-13
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-13
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-13
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-13
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-13
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 4e-13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-04
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-13
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-10
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 5e-13
2eaq_A90 LIM domain only protein 7; conserved hypothetical 9e-13
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 9e-13
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 9e-13
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 9e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-12
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-12
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-12
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-10
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-12
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-12
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 5e-12
2opg_A98 Multiple PDZ domain protein; structural protein, s 5e-12
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-12
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 7e-12
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 7e-12
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-12
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-11
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-11
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-11
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-11
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-11
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-11
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-11
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-11
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-11
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-08
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-11
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-10
2byg_A117 Channel associated protein of synapse-110; DLG2, P 3e-11
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-11
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-11
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-11
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 3e-11
2awx_A105 Synapse associated protein 97; membrane protein, s 3e-11
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-11
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-11
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 4e-11
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 4e-11
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 5e-11
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 5e-11
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 6e-11
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 6e-11
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-11
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 7e-11
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 7e-11
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 9e-11
2v90_A96 PDZ domain-containing protein 3; membrane, protein 9e-11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 9e-11
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 9e-11
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 9e-11
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-10
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-10
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 1e-10
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-10
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-10
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-10
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-10
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-10
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-10
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-10
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 3e-10
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-10
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 3e-10
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-10
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 4e-10
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-10
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-10
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-10
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 8e-10
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 9e-10
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-09
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-09
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-09
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-09
2ego_A96 General receptor for phosphoinositides 1- associat 1e-09
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-09
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-09
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-09
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-09
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-09
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-09
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-09
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-09
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-09
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-09
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 4e-09
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 4e-09
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-09
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 5e-09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 5e-09
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 5e-09
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 5e-09
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 5e-09
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 7e-09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 9e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 9e-09
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-08
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-08
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 1e-08
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-08
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 1e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-06
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-08
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-08
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-08
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-08
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 4e-08
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 6e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 7e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 8e-08
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-07
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-07
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-07
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-07
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-07
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-07
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-06
4fgm_A597 Aminopeptidase N family protein; structural genomi 4e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 8e-06
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 9e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 9e-06
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 2e-05
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 5e-05
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 8e-05
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 8e-05
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-04
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 4e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 9e-04
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
 Score = 97.2 bits (242), Expect = 8e-27
 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 2/108 (1%)

Query: 66  KSSIQHNTSTLTRTHVCKDERSGEPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSL 125
                H++S  T     +      P   +++ RK  ++G+ L GGN VGI+V  V   S 
Sbjct: 4   SHHHHHHSSGGTENLYFQGHMILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSP 63

Query: 126 GYSAGLRTGDRILEYNGTDLRAATAEEAAYEL--AKPADKVTVLAHSD 171
               GL  GD+IL  N  D      EEA   L      ++VT+LA   
Sbjct: 64  AAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKK 111


>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.78
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.74
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.73
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.73
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.73
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.73
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.72
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.72
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.72
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.71
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.71
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.71
2ego_A96 General receptor for phosphoinositides 1- associat 99.71
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.71
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.71
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.71
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.71
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.7
2awx_A105 Synapse associated protein 97; membrane protein, s 99.7
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.7
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.7
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.7
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.7
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.7
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.7
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.7
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.69
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.69
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.69
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.69
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.69
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.69
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.69
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.69
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.69
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.68
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.68
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.68
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.68
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.68
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.68
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.68
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.68
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.68
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.68
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.68
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.68
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.68
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.67
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.67
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.67
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.67
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.67
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.67
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.67
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.67
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.67
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.67
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.67
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.67
2d90_A102 PDZ domain containing protein 1; structural genomi 99.67
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.67
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.67
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.66
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.66
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.66
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.66
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.66
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.66
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.66
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.66
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.66
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.66
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.66
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.66
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.66
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.65
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.65
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.65
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.65
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.65
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.65
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.65
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.65
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.65
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.64
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.64
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.64
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.64
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.64
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.64
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.63
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.63
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.63
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.63
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.63
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.63
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.63
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.62
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.62
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.62
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.62
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.62
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.62
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.61
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.61
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.61
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.61
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.61
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.61
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.61
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.6
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.6
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.6
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.6
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.6
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.6
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.6
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.6
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.59
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.58
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.58
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.58
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.58
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.58
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.58
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.58
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.58
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.57
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.57
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.34
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.57
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.56
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.56
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.55
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.55
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.54
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.54
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.54
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.54
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 99.54
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.54
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.54
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.53
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.53
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.53
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.53
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.52
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.51
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.5
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.5
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.49
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.49
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.48
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.48
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.48
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.47
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.46
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.46
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.44
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.43
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.4
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.4
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.4
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.35
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.34
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.32
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.25
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.25
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.21
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.91
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.9
2kl1_A94 YLBL protein; structure genomics, structural genom 98.87
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.85
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.84
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.84
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.82
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.82
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.81
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.8
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.74
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.74
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.72
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.72
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.69
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.67
3k50_A 403 Putative S41 protease; structural genomics, joint 98.67
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.65
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.63
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.58
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.55
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.52
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.52
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.41
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.41
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 98.13
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.1
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.1
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.05
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.01
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.6
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 96.26
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 96.23
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 94.16
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 93.64
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 93.42
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 93.02
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 92.87
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 92.87
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 92.55
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 92.41
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 92.33
4amh_A106 Disks large homolog 1; permutation, protein foldin 92.06
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 91.64
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 91.49
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 91.47
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 91.36
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 91.32
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 91.2
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 91.09
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 90.99
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 90.83
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 90.77
2awx_A105 Synapse associated protein 97; membrane protein, s 90.6
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 90.53
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 90.47
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 90.46
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 90.41
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 90.33
2opg_A98 Multiple PDZ domain protein; structural protein, s 90.29
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 90.21
3khf_A99 Microtubule-associated serine/threonine-protein ki 89.87
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 89.75
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 89.75
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 89.68
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 89.66
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 89.65
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 89.53
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 89.34
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 88.94
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 88.77
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 88.66
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 88.57
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 88.45
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 88.41
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 88.21
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 88.07
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 88.06
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 87.89
2v90_A96 PDZ domain-containing protein 3; membrane, protein 87.81
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 87.48
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 87.24
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 87.04
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 86.73
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 86.06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 85.36
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 85.33
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 85.21
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 84.49
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 84.45
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 84.35
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 84.13
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 83.91
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 83.72
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 83.52
2d90_A102 PDZ domain containing protein 1; structural genomi 83.28
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 83.25
2eei_A106 PDZ domain-containing protein 1; regulatory factor 82.95
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 82.58
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 82.32
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 82.11
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 81.59
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 80.21
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
Probab=99.78  E-value=2e-18  Score=111.91  Aligned_cols=77  Identities=22%  Similarity=0.314  Sum_probs=71.8

Q ss_pred             CCEEEEEEccCCCcccEEEEccCCCCEEEEEecCCCcccccCCCCCCEEEEECCEecCCCCHHHHHHHHhCCCCeEEEEE
Q psy7774          89 EPRFLMIETRKCSNLGISLVGGNAVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRAATAEEAAYELAKPADKVTVLA  168 (173)
Q Consensus        89 ~~~~v~l~~~~~~~lG~~l~gg~~~~i~V~~v~~gs~A~~~gL~~gD~Il~Vng~~~~~~~~~~~~~~l~~~g~~v~l~v  168 (173)
                      ++|.|+|.|...++|||++.+|     +|..+.+++||+++||+.||+|++|||+++.+++|++++.+|+.++..|+|+|
T Consensus         4 ~~r~v~l~k~~~g~~Gf~i~~g-----~I~~v~~gspA~~aGl~~GD~Il~VNG~~v~~~~~~evv~llr~~g~~V~L~v   78 (82)
T 1r6j_A            4 DPRTITMHKDSTGHVGFIFKNG-----KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITI   78 (82)
T ss_dssp             CCEEEEEECCTTSCCCEEEETT-----EEEEECTTSHHHHHTCCSSEEEEEETTEECTTCCHHHHHHHHHHSCSEEEEEE
T ss_pred             ceEEEEEEECCCCCeEEEEECC-----EEEEecCCCHHHHcCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCEEEEEE
Confidence            6899999998867899999875     48999999999999999999999999999999999999999999999999998


Q ss_pred             EE
Q psy7774         169 HS  170 (173)
Q Consensus       169 ~r  170 (173)
                      ..
T Consensus        79 ~p   80 (82)
T 1r6j_A           79 MP   80 (82)
T ss_dssp             EE
T ss_pred             Ee
Confidence            75



>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 4e-15
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 1e-14
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-13
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-13
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 6e-13
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 8e-13
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-13
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 9e-13
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-12
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-12
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 4e-12
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 6e-12
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-12
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-11
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 6e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 1e-11
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-11
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-11
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 3e-11
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 6e-11
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-10
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 2e-10
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-10
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 3e-10
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 3e-10
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 5e-10
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 8e-10
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 9e-10
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-09
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-09
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-09
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-09
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-09
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 2e-09
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-09
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-09
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 6e-09
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 6e-09
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 6e-09
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-09
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 1e-08
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-08
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-08
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 2e-08
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-08
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-08
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 6e-08
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 7e-08
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-07
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-07
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-07
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-07
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-07
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 7e-07
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 7e-07
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-06
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-06
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-06
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 4e-06
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 4e-06
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-06
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 8e-06
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 1e-05
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 3e-05
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-04
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.001
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Na+/H+ exchanger regulatory factor, NHERF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.2 bits (159), Expect = 4e-15
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 89  EPRFLMIETRKCSNLGISLVGGN-AVGIYVHSVQSGSLGYSAGLRTGDRILEYNGTDLRA 147
            PR   +E +  +  G  L G    +G Y+  V+ GS    AGL  GDR++E NG ++  
Sbjct: 3   LPRLCCLE-KGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEK 61

Query: 148 ATAEEAAYELAKPADKVTVL 167
            T ++    +    + V +L
Sbjct: 62  ETHQQVVSRIRAALNAVRLL 81


>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.85
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.83
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.82
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.82
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.82
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.82
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.82
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.81
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.81
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.8
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.8
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.8
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.79
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.79
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.79
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.79
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.79
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.78
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.78
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.77
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.77
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.77
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.76
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.76
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.76
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.75
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.75
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.74
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.74
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.74
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.74
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.73
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.73
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.72
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.72
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.72
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.72
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.71
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.71
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.7
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.7
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.69
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.69
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.69
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.68
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.66
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.63
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.62
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.61
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.6
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.5
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.43
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.16
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.02
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.99
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.95
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.94
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.92
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.86
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.42
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.37
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 97.25
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 97.11
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.09
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.06
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 97.05
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 97.0
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 96.96
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 96.81
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 96.72
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 96.72
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 96.71
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 96.58
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.54
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 96.44
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 96.43
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 96.19
d1y7na179 Amyloid beta A4 precursor protein-binding family A 95.97
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 95.92
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 95.88
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 95.71
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 95.59
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 95.31
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 94.79
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 93.7
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 92.58
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 92.38
d1fc6a392 Photosystem II D1 C-terminal processing protease { 91.43
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 89.03
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 84.04
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 83.25
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 83.09
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Multiple PDZ domain protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=5.1e-21  Score=126.35  Aligned_cols=83  Identities=36%  Similarity=0.571  Sum_probs=74.2

Q ss_pred             CCEEEEEEccCCCcccEEEEccC-----------CCCEEEEEecCCCcccccC-CCCCCEEEEECCEecCCCCHHHHHHH
Q psy7774          89 EPRFLMIETRKCSNLGISLVGGN-----------AVGIYVHSVQSGSLGYSAG-LRTGDRILEYNGTDLRAATAEEAAYE  156 (173)
Q Consensus        89 ~~~~v~l~~~~~~~lG~~l~gg~-----------~~~i~V~~v~~gs~A~~~g-L~~gD~Il~Vng~~~~~~~~~~~~~~  156 (173)
                      +||+|+|.|.++.+|||+|.||.           ..++||..|.++|+|+++| |++||+|++|||.++.+++|++++.+
T Consensus         1 qpr~V~l~k~~~~~lG~~i~gg~~~~~~~~~~~~~~gi~V~~v~~~s~A~~~G~L~~GD~Il~VNg~~v~~~t~~ea~~~   80 (96)
T d2fcfa1           1 QPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEA   80 (96)
T ss_dssp             SCEEEEECCCC-CCCCEEEECCCC-------------EEEEEECSSSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHH
T ss_pred             CCEEEEEEeCCCCCCCEEEEcccCCCcccccccCCCCEEEEEECCCCHHHHcCCCcCCCEEEEECCEECCCCCHHHHHHH
Confidence            47999999988889999999864           2489999999999999976 99999999999999999999999999


Q ss_pred             HhCCCCeEEEEEEEC
Q psy7774         157 LAKPADKVTVLAHSD  171 (173)
Q Consensus       157 l~~~g~~v~l~v~r~  171 (173)
                      |+++++.++|+|+|.
T Consensus        81 lk~~~~~v~L~V~r~   95 (96)
T d2fcfa1          81 IRKAGNPVVFMVQSI   95 (96)
T ss_dssp             HHTCCSSEEEEEECC
T ss_pred             HHcCCCeEEEEEEEc
Confidence            999999999999974



>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure