Diaphorina citri psyllid: psy77


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MLMIQHTDEVVKGSMVIAHYKIPRYVEFVADFPKTVSGKIQKYVLSKQMEDKMILIIAVIHCQVQAYLSGLLDSE
cccHHHHHHHHHccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccc
MLMIQHTDEVVKGSMVIAHYKIPRYVEFVADFPKTVSGKIQKYVLSKQMEDKMILIIAVIHCQVQAYLSGLLD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLMIQHTDEVVKGSMVIAHYKIPRYVEFVADFPKTVSGKIQKYVLSKQMEDKMILIIAVIHCQVQAYLSGLLDSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ0P4F7
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ5R9G9
Acyl-CoA synthetase family member 2, mitochondrial Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.confidentQ96CM8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MDB, chain A
Confidence level:very confident
Coverage over the Query: 2-53
View the alignment between query and template
View the model in PyMOL
Template: 3RG2, chain A
Confidence level:confident
Coverage over the Query: 2-73
View the alignment between query and template
View the model in PyMOL