Diaphorina citri psyllid: psy7830

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MTLFGRPLKIERCVLAVFFILVSRGQGWKPDPGMPIEPPPDLRSEMYDEDNENEENFFYTRSYADFLEGLKERKLLNHPRVEEAFYAVRRADFINVKPKFGFCDIPYAFANQVVMEPPSYIARCLEQLVDHLQNGSRVLDIGSGQGYMATAKEWLSSVRQLLLPETLNNSLKNIKISRPDLLQSKTLEFILKDARWGHAEGGPYDVIFFGAGTTEVSKTILSQLKPNGRIVAPVGNVWRQNLSVIDKGPDGSISSKILRRVSSDFLCNLEYQLHPDVFPQPLNTSAEDTYTKMFPPPPGVRPRAVTFPLSSQERSPGNGSTKKYEFLPESTEDRYIFPQHILDILHGPNKTKSRHVQSKVTLLI
ccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHcccccEEEEEECcHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEccccccccHHHHHccccccEEEEEEcccccEEEEEEEEcccccEEEEEEccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccEEEEcc
***FGRPLKIERCVLAVFFILVSRGQGW***************************NFFYTRSYADFLEGLKERKLLNHPRVEEAFYAVRRADFINVKPKFGFCDIPYAFANQVVMEPPSYIARCLEQLVDHLQNGSRVLDIGSGQGYMATAKEWLSSVRQLLLPETLNNSLKNIKISRPDLLQSKTLEFILKDARWGHAEGGPYDVIFFGAGTTEVSKTILSQLKPNGRIVAPVGNVWRQNLSVIDKGPDGSISSKILRRVSSDFLCNLEYQL******************************************************PESTEDRYIFPQHILDILHGPNKT***HVQSKVTLLI
xxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLFGRPLKIERCVLAVFFILVSRGQGWKPDPGMPIEPPPDLRSEMYDEDNENEENFFYTRSYADFLEGLKERKLLNHPRVEEAFYAVRRADFINVKPKFGFCDIPYAFANQVVMEPPSYIARCLEQLVDHLQNGSRVLDIGSGQGYMATAKEWLSSVRQLLLPETLNNSLKNIKISRPDLLQSKTLEFILKDARWGHAEGGPYDVIFFGAGTTEVSKTILSQLKPNGRIVAPVGNVWRQNLSVIDKGPDGSISSKILRRVSSDFLCNLEYQLHPDVFPQPLNTSAEDTYTKMFPPPPGVRPRAVTFPLSSQERSPGNGSTKKYEFLPESTEDRYIFPQHILDILHGPNKTKSRHVQSKVTLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein-L-isoaspartate O-methyltransferase Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.confidentQ9GPS6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I1N, chain A
Confidence level:very confident
Coverage over the Query: 62-269
View the alignment between query and template
View the model in PyMOL
Template: 2FRX, chain A
Confidence level:confident
Coverage over the Query: 42-237
View the alignment between query and template
View the model in PyMOL