Diaphorina citri psyllid: psy7831


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE
cccccccccccccEEEEEEccEEEEEccccccccHHHHHHHcccccccccccccccccccCEEEEcccccccccEEEEEccHHHHHHHHHcccEEECccccccccccccHHHHHHHHccccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHcccc
**************VKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCA*I*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbon monoxide dehydrogenase small chain Catalyzes the oxidation of carbon monoxide to carbon dioxide.confidentP19921

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0016725 [MF]oxidoreductase activity, acting on CH or CH2 groupsprobableGO:0003824, GO:0003674, GO:0016491
GO:0042597 [CC]periplasmic spaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0050302 [MF]indole-3-acetaldehyde oxidase activityprobableGO:0004031, GO:0016623, GO:0003824, GO:0016903, GO:0003674, GO:0018488, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T3Q, chain A
Confidence level:very confident
Coverage over the Query: 10-68,79-127,144-194
View the alignment between query and template
View the model in PyMOL
Template: 3VR8, chain B
Confidence level:confident
Coverage over the Query: 2-68,79-178
View the alignment between query and template
View the model in PyMOL