Psyllid ID: psy7831

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE
cccccccccccccEEEEEEccEEEEEccccccccHHHHHHHcccccccccccccccccccEEEEEcccccccccEEEEEccHHHHHHHHHcccEEEEccccccccccccHHHHHHHHccccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHcHHHHHHHcccc
cccccccccccccEEEEEEccEEEEEcccccHHcEHHHHHHHcccccccccccccccccccEEEEEEEEcccEEEEEEEEEccccEHHHccccEEEcHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHHHHHcHcccccccccccccc
mvyredplpkagKEVKFALNEKFytvgedvpvgtRLVDFIRDVaglkgtkymcreggcgvctvmvksrhpvtKELLVYSVNACLVYVQMCNgwsiytidglgdkkhgyHKVQSRLAlmngtqcgycspgmvmamhrtqcgycspgmvMAMHSFLMEHDYKVGKADVERAlggnicrctgyrpildtfqsfaTDACDRVRQKCADIE
mvyredplpkagKEVKFALNEKFytvgedvpvgtrlVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE
**************VKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVR*******
***************KFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMH************ADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCA*I*
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRV********
**********AGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADI*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYREDPLPKAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q12553 1363 Xanthine dehydrogenase OS yes N/A 0.771 0.116 0.396 1e-32
Q7G191 1337 Benzaldehyde dehydrogenas yes N/A 0.830 0.127 0.385 2e-32
Q7G192 1321 Indole-3-acetaldehyde oxi no N/A 0.781 0.121 0.340 1e-27
Q54FB7 1358 Xanthine dehydrogenase OS yes N/A 0.825 0.125 0.353 2e-27
P10351 1335 Xanthine dehydrogenase OS no N/A 0.728 0.112 0.389 2e-26
P47990 1358 Xanthine dehydrogenase/ox yes N/A 0.815 0.123 0.387 2e-26
P91711 1344 Xanthine dehydrogenase OS N/A N/A 0.728 0.111 0.371 1e-25
Q6AUV1 1369 Xanthine dehydrogenase OS yes N/A 0.674 0.101 0.403 1e-25
P22811 1343 Xanthine dehydrogenase OS no N/A 0.791 0.121 0.370 2e-25
Q8GUQ8 1361 Xanthine dehydrogenase 1 no N/A 0.674 0.102 0.429 4e-25
>sp|Q12553|XDH_EMENI Xanthine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hxA PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 73/184 (39%), Positives = 109/184 (59%), Gaps = 25/184 (13%)

Query: 22  KFYTVGEDVPVGT-----RLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELL 76
           +FY  G  V + +      L++++R + GL GTK  C EGGCG CTV+V   +P TK+L 
Sbjct: 38  RFYLNGTKVILDSVDPEITLLEYLRGI-GLTGTKLGCAEGGCGACTVVVSQINPTTKKLY 96

Query: 77  VYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHR 136
             S+NAC+  +   +G  + T++G+G+ K+  H +Q RLA+ NG+QCG+C+PG+VM+++ 
Sbjct: 97  HASINACIAPLVAVDGKHVITVEGIGNVKNP-HAIQQRLAIGNGSQCGFCTPGIVMSLYA 155

Query: 137 TQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATD-AC 195
                            L+ +D K  +  VE A  GN+CRCTGYRPILD  QSF +   C
Sbjct: 156 -----------------LLRNDPKPSEHAVEEAFDGNLCRCTGYRPILDAAQSFTSPIGC 198

Query: 196 DRVR 199
            + R
Sbjct: 199 GKAR 202
Key enzyme in purine degradation. Catalyzes the oxidation of hypoxanthine to xanthine. Catalyzes the oxidation of xanthine to uric acid.
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (taxid: 227321)
EC: 1EC: .EC: 1EC: 7EC: .EC: 1EC: .EC: 4
>sp|Q7G191|ALDO4_ARATH Benzaldehyde dehydrogenase (NAD(+)) OS=Arabidopsis thaliana GN=AAO4 PE=1 SV=2 Back     alignment and function description
>sp|Q7G192|ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana GN=AAO2 PE=1 SV=2 Back     alignment and function description
>sp|Q54FB7|XDH_DICDI Xanthine dehydrogenase OS=Dictyostelium discoideum GN=xdh PE=3 SV=1 Back     alignment and function description
>sp|P10351|XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster GN=ry PE=2 SV=2 Back     alignment and function description
>sp|P47990|XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus GN=XDH PE=1 SV=1 Back     alignment and function description
>sp|P91711|XDH_DROSU Xanthine dehydrogenase OS=Drosophila subobscura GN=Xdh PE=3 SV=1 Back     alignment and function description
>sp|Q6AUV1|XDH_ORYSJ Xanthine dehydrogenase OS=Oryza sativa subsp. japonica GN=XDH PE=2 SV=1 Back     alignment and function description
>sp|P22811|XDH_DROPS Xanthine dehydrogenase OS=Drosophila pseudoobscura pseudoobscura GN=ry PE=3 SV=2 Back     alignment and function description
>sp|Q8GUQ8|XDH1_ARATH Xanthine dehydrogenase 1 OS=Arabidopsis thaliana GN=XDH1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
157126015 1266 aldehyde oxidase [Aedes aegypti] gi|1088 0.859 0.139 0.494 1e-49
403183119 513 AAEL017311-PA [Aedes aegypti] 0.844 0.339 0.523 2e-48
170057108 1265 aldehyde oxidase [Culex quinquefasciatus 0.854 0.139 0.487 8e-48
170057106 1266 aldehyde oxidase [Culex quinquefasciatus 0.859 0.139 0.510 3e-47
170066162 1280 xanthine dehydrogenase [Culex quinquefas 0.864 0.139 0.487 5e-47
157126053 1278 aldehyde oxidase [Aedes aegypti] gi|1088 0.864 0.139 0.507 5e-47
118786782 1286 AGAP005636-PA [Anopheles gambiae str. PE 0.849 0.136 0.520 6e-47
158295570 1149 AGAP006220-PA [Anopheles gambiae str. PE 0.854 0.153 0.507 6e-47
158294523 1286 AGAP005638-PA [Anopheles gambiae str. PE 0.849 0.136 0.520 7e-47
170057110 1288 xanthine dehydrogenase/oxidase [Culex qu 0.864 0.138 0.507 1e-46
>gi|157126015|ref|XP_001654494.1| aldehyde oxidase [Aedes aegypti] gi|108873420|gb|EAT37645.1| AAEL010367-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 126/194 (64%), Gaps = 17/194 (8%)

Query: 14  EVKFALNEKFYTVG-EDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVT 72
           E++F++N K Y +  +++P+   L  FIR+ A LKGTK+MC EGGCG C V V S HPVT
Sbjct: 2   EIQFSINGKLYNLNPKEIPIEISLNTFIRNHAQLKGTKFMCLEGGCGACAVNVSSIHPVT 61

Query: 73  KELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVM 132
            ++  ++VN+CL+ V  C+G  I T++G+G+KK GYH VQ RLA  NG+QCGYCS     
Sbjct: 62  GKISSFAVNSCLLPVYSCHGLDILTVEGIGNKKIGYHPVQKRLAQFNGSQCGYCS----- 116

Query: 133 AMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFAT 192
                       GMVM+M S L  +D  V   DVE A  GN+CRCTGYRPI+D F+SFAT
Sbjct: 117 -----------SGMVMSMFSLLKANDGSVTMKDVENAFDGNVCRCTGYRPIMDAFKSFAT 165

Query: 193 DACDRVRQKCADIE 206
           DA   V + C D+E
Sbjct: 166 DASSSVMKLCRDVE 179

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|403183119|gb|EJY57867.1| AAEL017311-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170057108|ref|XP_001864335.1| aldehyde oxidase [Culex quinquefasciatus] gi|167876657|gb|EDS40040.1| aldehyde oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170057106|ref|XP_001864334.1| aldehyde oxidase [Culex quinquefasciatus] gi|167876656|gb|EDS40039.1| aldehyde oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170066162|ref|XP_001868138.1| xanthine dehydrogenase [Culex quinquefasciatus] gi|167862792|gb|EDS26175.1| xanthine dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157126053|ref|XP_001654513.1| aldehyde oxidase [Aedes aegypti] gi|108873439|gb|EAT37664.1| AAEL010372-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|118786782|ref|XP_315654.3| AGAP005636-PA [Anopheles gambiae str. PEST] gi|116126486|gb|EAA11752.3| AGAP005636-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295570|ref|XP_001688830.1| AGAP006220-PA [Anopheles gambiae str. PEST] gi|157016102|gb|EDO63836.1| AGAP006220-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158294523|ref|XP_315656.4| AGAP005638-PA [Anopheles gambiae str. PEST] gi|157015602|gb|EAA11737.5| AGAP005638-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170057110|ref|XP_001864336.1| xanthine dehydrogenase/oxidase [Culex quinquefasciatus] gi|167876658|gb|EDS40041.1| xanthine dehydrogenase/oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
FB|FBgn0038347 1273 CG18522 [Drosophila melanogast 0.781 0.126 0.491 3.2e-39
FB|FBgn0038348 1285 CG18519 [Drosophila melanogast 0.854 0.136 0.455 2.2e-37
UNIPROTKB|P48034 1339 AOX1 "Aldehyde oxidase" [Bos t 0.606 0.093 0.412 2.2e-37
UNIPROTKB|F1MAK6 1346 Aox3l1 "Protein Aox3l1" [Rattu 0.621 0.095 0.442 2.3e-37
UNIPROTKB|D4A4N8 1345 Aox3l1 "Protein Aox3l1" [Rattu 0.621 0.095 0.438 3.8e-37
UNIPROTKB|D4A6S5 1345 Aox3l1 "Protein Aox3l1" [Rattu 0.621 0.095 0.438 3.8e-37
UNIPROTKB|F1PI09 1346 AOH3 "Uncharacterized protein" 0.621 0.095 0.403 1.3e-36
ASPGD|ASPL0000027538 1363 hxA [Emericella nidulans (taxi 0.572 0.086 0.404 4.4e-36
UNIPROTKB|Q12553 1363 hxA "Xanthine dehydrogenase" [ 0.572 0.086 0.404 4.4e-36
UNIPROTKB|F1MRY9 1339 AOX1 "Aldehyde oxidase" [Bos t 0.606 0.093 0.396 5.3e-36
FB|FBgn0038347 CG18522 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 3.2e-39, P = 3.2e-39
 Identities = 87/177 (49%), Positives = 112/177 (63%)

Query:    30 VPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQM 89
             +P    L  FIR+ AGL GTK+MC+EGGCGVC   +   HP T EL  ++VN+CL  +  
Sbjct:    19 LPADISLNTFIREYAGLTGTKFMCQEGGCGVCVCTLTGIHPETGELRTWAVNSCLTLLNT 78

Query:    90 CNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMA 149
             C G  + T +GLG+K+ GYH +Q RLA MNGTQCGYCSPG+VM M+         G++ +
Sbjct:    79 CLGLEVTTSEGLGNKRVGYHAIQQRLAKMNGTQCGYCSPGIVMNMY---------GLLKS 129

Query:   150 MHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDACDRVRQKCADIE 206
                       KV   +VE + GGNICRCTGYRPILD  +SFA D+  +V  +C DIE
Sbjct:   130 KGG-------KVTMEEVENSFGGNICRCTGYRPILDAMKSFAVDSNIQVPAECIDIE 179
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016614 "oxidoreductase activity, acting on CH-OH group of donors" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
FB|FBgn0038348 CG18519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P48034 AOX1 "Aldehyde oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAK6 Aox3l1 "Protein Aox3l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4N8 Aox3l1 "Protein Aox3l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6S5 Aox3l1 "Protein Aox3l1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI09 AOH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ASPGD|ASPL0000027538 hxA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q12553 hxA "Xanthine dehydrogenase" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRY9 AOX1 "Aldehyde oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P19921DCMS_OLICO1, ., 2, ., 9, 9, ., 20.32900.62130.7710yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
PLN02906 1319 PLN02906, PLN02906, xanthine dehydrogenase 5e-47
TIGR02963 467 TIGR02963, xanthine_xdhA, xanthine dehydrogenase, 5e-41
PLN00192 1344 PLN00192, PLN00192, aldehyde oxidase 8e-41
COG4630 493 COG4630, XdhA, Xanthine dehydrogenase, iron-sulfur 1e-37
TIGR02969 1330 TIGR02969, mam_aldehyde_ox, aldehyde oxidase 2e-36
COG2080156 COG2080, CoxS, Aerobic-type carbon monoxide dehydr 3e-33
TIGR03193148 TIGR03193, 4hydroxCoAred, 4-hydroxybenzoyl-CoA red 2e-25
TIGR03311 848 TIGR03311, Se_dep_Molyb_1, selenium-dependent moly 7e-23
TIGR03198151 TIGR03198, pucE, xanthine dehydrogenase E subunit 2e-22
pfam0179975 pfam01799, Fer2_2, [2Fe-2S] binding domain 5e-20
PRK11433217 PRK11433, PRK11433, aldehyde oxidoreductase 2Fe-2S 2e-18
PRK09908159 PRK09908, PRK09908, xanthine dehydrogenase subunit 7e-16
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 6e-05
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 6e-04
>gnl|CDD|215491 PLN02906, PLN02906, xanthine dehydrogenase Back     alignment and domain information 
 Score =  164 bits (418), Expect = 5e-47
 Identities = 65/159 (40%), Positives = 93/159 (58%), Gaps = 17/159 (10%)

Query: 36  LVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWSI 95
           L++++RD+ GL GTK  C EGGCG CTVMV      T + + Y+VNACL  +    G  +
Sbjct: 4   LLEYLRDL-GLTGTKLGCGEGGCGACTVMVSHYDRKTGKCVHYAVNACLAPLYSVEGMHV 62

Query: 96  YTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLM 155
            T++G+G+++ G H VQ  LA M+G                +QCG+C+PG +M+M++ L 
Sbjct: 63  ITVEGIGNRRDGLHPVQEALASMHG----------------SQCGFCTPGFIMSMYALLR 106

Query: 156 EHDYKVGKADVERALGGNICRCTGYRPILDTFQSFATDA 194
                  +  +E  L GN+CRCTGYRPILD F+ FA   
Sbjct: 107 SSKTPPTEEQIEECLAGNLCRCTGYRPILDAFRVFAKTD 145

Length = 1319
>gnl|CDD|234072 TIGR02963, xanthine_xdhA, xanthine dehydrogenase, small subunit Back     alignment and domain information
>gnl|CDD|215096 PLN00192, PLN00192, aldehyde oxidase Back     alignment and domain information
>gnl|CDD|226977 COG4630, XdhA, Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|132014 TIGR02969, mam_aldehyde_ox, aldehyde oxidase Back     alignment and domain information
>gnl|CDD|224991 COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132237 TIGR03193, 4hydroxCoAred, 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>gnl|CDD|132354 TIGR03311, Se_dep_Molyb_1, selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>gnl|CDD|132242 TIGR03198, pucE, xanthine dehydrogenase E subunit Back     alignment and domain information
>gnl|CDD|201981 pfam01799, Fer2_2, [2Fe-2S] binding domain Back     alignment and domain information
>gnl|CDD|236910 PRK11433, PRK11433, aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>gnl|CDD|182139 PRK09908, PRK09908, xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 100.0
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 100.0
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 100.0
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 100.0
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 100.0
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 100.0
KOG0430|consensus 1257 100.0
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 100.0
PLN00192 1344 aldehyde oxidase 100.0
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 100.0
PRK09800 956 putative hypoxanthine oxidase; Provisional 100.0
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 100.0
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 100.0
PLN02906 1319 xanthine dehydrogenase 100.0
PF0179975 Fer2_2: [2Fe-2S] binding domain; InterPro: IPR0028 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 99.92
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 99.91
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 99.9
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 99.9
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 99.89
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 99.89
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 99.87
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 99.87
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 99.87
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 99.86
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 99.81
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 99.75
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.67
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 99.61
KOG3049|consensus288 99.5
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.84
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 98.64
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.63
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 98.49
PRK08493 819 NADH dehydrogenase subunit G; Validated 98.49
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 98.34
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 98.03
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 97.93
CHL0013499 petF ferredoxin; Validated 97.9
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 97.68
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 97.66
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.59
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.58
PLN03136148 Ferredoxin; Provisional 97.58
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.56
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 97.46
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.46
PRK08166 847 NADH dehydrogenase subunit G; Validated 97.42
PTZ00490143 Ferredoxin superfamily; Provisional 97.41
PTZ00038191 ferredoxin; Provisional 97.26
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 97.22
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 97.2
COG0633102 Fdx Ferredoxin [Energy production and conversion] 97.0
PLN02593117 adrenodoxin-like ferredoxin protein 97.0
PRK05713 312 hypothetical protein; Provisional 96.92
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 96.7
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 96.66
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 96.61
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 96.55
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 96.51
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.2
KOG2282|consensus 708 92.0
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 91.88
PRK0744070 hypothetical protein; Provisional 90.57
COG210468 ThiS Sulfur transfer protein involved in thiamine 89.32
PRK0836470 sulfur carrier protein ThiS; Provisional 88.65
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 87.72
PRK0565966 sulfur carrier protein ThiS; Validated 86.75
PRK0805366 sulfur carrier protein ThiS; Provisional 85.74
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and co 84.77
PRK0608384 sulfur carrier protein ThiS; Provisional 84.58
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 83.67
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 83.06
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 81.87
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 80.02
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information 
Probab=100.00  E-value=2e-59  Score=378.62  Aligned_cols=147  Identities=35%  Similarity=0.720  Sum_probs=142.2

Q ss_pred             EEEEECCEEEEEeecCCCCCcHHHHHHhhcCCCCCcccCCCCCccceEEEEccccCCCcccccccccchhhhhhhcCCCe
Q psy7831          15 VKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCNGWS   94 (206)
Q Consensus        15 i~f~vNG~~~~v~~~~~p~~tLLd~LR~~~~l~g~K~gC~eG~CGACtVlVdG~~~~~~~~~~~~v~sCl~~~~~~~g~~   94 (206)
                      ++|+|||+++++  +++|+++|+|+||++++++|+|.||++|.||||+|+|||+          +|+||++++.+++|++
T Consensus         2 i~~~vNG~~~~~--~~~~~~~Ll~~LR~~lgltg~K~gC~~G~CGACtVlvdg~----------~v~SCl~~~~~~~G~~   69 (148)
T TIGR03193         2 LRLTVNGRWRED--AVADNMLLVDYLRDTVGLTGTKQGCDGGECGACTVLVDGR----------PRLACSTLAHRVAGRK   69 (148)
T ss_pred             EEEEECCEEEEe--ecCCCCcHHHHHHHhcCCCCCCCCCCCCCCCCCEEEECCe----------EeeccHhhHhhcCCCc
Confidence            689999999999  8999999999999999999999999999999999999999          9999999999999999


Q ss_pred             EEEEcCCCCCCCCccHHHHHHHHcCCCccccCCCCccccccccccCCCCchHHHHHHHHHHhCCCCCCHHHHHHHhcCCc
Q psy7831          95 IYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNI  174 (206)
Q Consensus        95 I~TvEgL~~~~~~~~~vq~a~~~~~~~QCG~Ct~~~~~~~~~~~~~~~~PG~vm~~~~ll~~~~~~~~~~ei~~al~gnl  174 (206)
                      |+|||||++. +.+||+|++|++++++||||||                |||+|++++||+++| +|+++||+++|+|||
T Consensus        70 V~TiEgl~~~-~~l~pvq~af~~~~a~QCGfCt----------------PG~vms~~~ll~~~p-~ps~~ei~~al~GnL  131 (148)
T TIGR03193        70 VETVEGLATN-GRLSRLQQAFHERLGTQCGFCT----------------PGMIMAAEALLRRNP-SPSRDEIRAALAGNL  131 (148)
T ss_pred             EEEeCCCCCC-CCCCHHHHHHHHcCCCcCCCCC----------------ccHHHHHHHHHHcCC-CCCHHHHHHHHcCCc
Confidence            9999999864 5799999999999999999999                999999999999999 899999999999999


Q ss_pred             ccCCCCHHHHHHHHHHH
Q psy7831         175 CRCTGYRPILDTFQSFA  191 (206)
Q Consensus       175 CRCtgy~~i~~a~~~~a  191 (206)
                      ||||||++|++||+.++
T Consensus       132 CRCTGY~~I~~Av~~aa  148 (148)
T TIGR03193       132 CRCTGYVKIIESVEAAA  148 (148)
T ss_pred             cCCCCCHHHHHHHHHhC
Confidence            99999999999999874

4-hydroxybenzoyl-CoA reductase converts 4-hydroxybenzoyl-CoA to benzoyl-CoA, a common intermediate in the degradation of aromatic compounds. This protein family represents the gamma chain of this three-subunit enzyme.
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>KOG0430|consensus Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>PF01799 Fer2_2: [2Fe-2S] binding domain; InterPro: IPR002888 The [2Fe-2S] binding domain is found in a range of enzymes including dehydrogenases, oxidases and oxidoreductases Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG3049|consensus Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG2282|consensus Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3zyv_A 1335 Crystal Structure Of The Mouse Liver Aldehyde Oxyda 6e-25
1fo4_A 1332 Crystal Structure Of Xanthine Dehydrogenase Isolate 5e-23
1n5x_A 1331 Xanthine Dehydrogenase From Bovine Milk With Inhibi 5e-23
1fiq_A219 Crystal Structure Of Xanthine Oxidase From Bovine M 6e-23
3etr_A164 Crystal Structure Of Xanthine Oxidase In Complex Wi 8e-23
3una_A 1332 Crystal Structure Of Bovine Milk Xanthine Dehydroge 9e-23
3eub_A165 Crystal Structure Of Desulfo-Xanthine Oxidase With 1e-22
2e1q_A 1333 Crystal Structure Of Human Xanthine Oxidoreductase 1e-22
2ckj_A 1333 Human Milk Xanthine Oxidoreductase Length = 1333 1e-22
1wyg_A 1331 Crystal Structure Of A Rat Xanthine Dehydrogenase T 2e-22
2e3t_A 1331 Crystal Structure Of Rat Xanthine Oxidoreductase Mu 2e-22
3an1_A 1331 Crystal Structure Of Rat D428a Mutant, Urate Bound 2e-22
2w3r_A 462 Crystal Structure Of Xanthine Dehydrogenase (Desulf 3e-19
1jro_A 462 Crystal Structure Of Xanthine Dehydrogenase From Rh 4e-19
1n5w_A166 Crystal Structure Of The Cu,Mo-Co Dehydrogenase (Co 4e-19
1rm6_C161 Structure Of 4-Hydroxybenzoyl-Coa Reductase From Th 4e-17
1ffu_A163 Carbon Monoxide Dehydrogenase From Hydrogenophaga P 1e-15
1t3q_A168 Crystal Structure Of Quinoline 2-Oxidoreductase Fro 4e-15
1sij_A 907 Crystal Structure Of The Aldehyde Dehydrogenase (A. 6e-12
3hrd_D160 Crystal Structure Of Nicotinate Dehydrogenase Lengt 8e-11
1dgj_A 907 Crystal Structure Of The Aldehyde Oxidoreductase Fr 3e-09
>pdb|3ZYV|A Chain A, Crystal Structure Of The Mouse Liver Aldehyde Oxydase 3 (Maox3) Length = 1335 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 99/181 (54%), Gaps = 18/181 (9%)
Query: 10  KAGKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRH 69
           K   E+ F +N K  T     P    L+ ++R V  L GTKY C  G CG CTVM+    
Sbjct: 5   KESDELIFFVNGKKVTERNADP-EVNLLFYLRKVIRLTGTKYGCGGGDCGACTVMISRYD 63
Query: 70  PVTKELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPG 129
           P++K +  +S  ACLV +   +G ++ T++G+G  K   H VQ R+A  +GTQCG+C+PG
Sbjct: 64  PISKRISHFSATACLVPICSLHGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFCTPG 123
Query: 130 MVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQS 189
           MVM+++     +  P     M +                 LGGN+CRCTGYRPI+++ +S
Sbjct: 124 MVMSIYTLLRNHPEPSTEQIMET-----------------LGGNLCRCTGYRPIVESAKS 166
Query: 190 F 190
           F
Sbjct: 167 F 167
>pdb|1FO4|A Chain A, Crystal Structure Of Xanthine Dehydrogenase Isolated From Bovine Milk Length = 1332 Back     alignment and structure
>pdb|1N5X|A Chain A, Xanthine Dehydrogenase From Bovine Milk With Inhibitor Tei- 6720 Bound Length = 1331 Back     alignment and structure
>pdb|1FIQ|A Chain A, Crystal Structure Of Xanthine Oxidase From Bovine Milk Length = 219 Back     alignment and structure
>pdb|3ETR|A Chain A, Crystal Structure Of Xanthine Oxidase In Complex With Lumazine Length = 164 Back     alignment and structure
>pdb|3UNA|A Chain A, Crystal Structure Of Bovine Milk Xanthine Dehydrogenase With Nad Bound Length = 1332 Back     alignment and structure
>pdb|3EUB|A Chain A, Crystal Structure Of Desulfo-Xanthine Oxidase With Xanthine Length = 165 Back     alignment and structure
>pdb|2E1Q|A Chain A, Crystal Structure Of Human Xanthine Oxidoreductase Mutant, Glu803val Length = 1333 Back     alignment and structure
>pdb|2CKJ|A Chain A, Human Milk Xanthine Oxidoreductase Length = 1333 Back     alignment and structure
>pdb|1WYG|A Chain A, Crystal Structure Of A Rat Xanthine Dehydrogenase Triple Mutant (C535a, C992r And C1324s) Length = 1331 Back     alignment and structure
>pdb|2E3T|A Chain A, Crystal Structure Of Rat Xanthine Oxidoreductase Mutant (W335a And F336l) Length = 1331 Back     alignment and structure
>pdb|3AN1|A Chain A, Crystal Structure Of Rat D428a Mutant, Urate Bound Form Length = 1331 Back     alignment and structure
>pdb|2W3R|A Chain A, Crystal Structure Of Xanthine Dehydrogenase (Desulfo Form) From Rhodobacter Capsulatus In Complex With Hypoxanthine Length = 462 Back     alignment and structure
>pdb|1JRO|A Chain A, Crystal Structure Of Xanthine Dehydrogenase From Rhodobacter Capsulatus Length = 462 Back     alignment and structure
>pdb|1N5W|A Chain A, Crystal Structure Of The Cu,Mo-Co Dehydrogenase (Codh); Oxidized Form Length = 166 Back     alignment and structure
>pdb|1RM6|C Chain C, Structure Of 4-Hydroxybenzoyl-Coa Reductase From Thauera Aromatica Length = 161 Back     alignment and structure
>pdb|1FFU|A Chain A, Carbon Monoxide Dehydrogenase From Hydrogenophaga Pseudoflava Which Lacks The Mo-Pyranopterin Moiety Of The Molybdenum Cofactor Length = 163 Back     alignment and structure
>pdb|1T3Q|A Chain A, Crystal Structure Of Quinoline 2-Oxidoreductase From Pseudomonas Putida 86 Length = 168 Back     alignment and structure
>pdb|1SIJ|A Chain A, Crystal Structure Of The Aldehyde Dehydrogenase (A.K.A. Aor Or Mop) Of Desulfovibrio Gigas Covalently Bound To [aso3]- Length = 907 Back     alignment and structure
>pdb|3HRD|D Chain D, Crystal Structure Of Nicotinate Dehydrogenase Length = 160 Back     alignment and structure
>pdb|1DGJ|A Chain A, Crystal Structure Of The Aldehyde Oxidoreductase From Desulfovibrio Desulfuricans Atcc 27774 Length = 907 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 4e-67
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 5e-65
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 5e-55
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 3e-37
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 1e-36
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 6e-36
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 3e-35
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 6e-35
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 2e-34
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 5e-34
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Length = 164 Back     alignment and structure
 Score =  202 bits (516), Expect = 4e-67
 Identities = 64/179 (35%), Positives = 100/179 (55%), Gaps = 18/179 (10%)

Query: 13  KEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVT 72
            E+ F +N K     ++    T L+ ++R   GL+GTK  C EGGCG CTVM+     + 
Sbjct: 3   DELVFFVNGKKVVE-KNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQ 61

Query: 73  KELLVYSVNACLVYVQMCNGWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVM 132
            +++ +S NACL  +   +  ++ T++G+G  K   H VQ R+A  +G+QCG+C+     
Sbjct: 62  DKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCT----- 116

Query: 133 AMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPILDTFQSFA 191
                      PG+VM+M++ L     +    ++E A  GN+CRCTGYRPIL  F++FA
Sbjct: 117 -----------PGIVMSMYTLLRNQP-EPTVEEIEDAFQGNLCRCTGYRPILQGFRTFA 163
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Length = 1332 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Length = 462 Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Length = 166 Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Length = 160 Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Length = 161 Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Length = 163 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Length = 907 Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Length = 168 Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Length = 907 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 100.0
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 100.0
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 100.0
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 100.0
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 100.0
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 100.0
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 100.0
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 100.0
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 100.0
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 100.0
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 100.0
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 99.92
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 99.86
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 99.85
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 99.84
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 99.76
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 99.37
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 99.09
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 98.75
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 98.61
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 98.5
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 98.47
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 98.47
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 98.42
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 98.41
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 98.39
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 98.35
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 98.21
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 98.09
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 98.08
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 98.06
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 98.06
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 98.05
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 97.86
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 97.83
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 97.69
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 97.66
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 97.6
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 97.46
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 97.31
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 97.08
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 96.85
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.05
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 95.83
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 94.29
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 90.04
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 89.87
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 87.8
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 87.65
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
Probab=100.00  E-value=9.1e-63  Score=403.36  Aligned_cols=160  Identities=40%  Similarity=0.795  Sum_probs=150.9

Q ss_pred             ceEEEEECCEEE-EEeecCCCCCcHHHHHHhhcCCCCCcccCCCCCccceEEEEccccCCCcccccccccchhhhhhhcC
Q psy7831          13 KEVKFALNEKFY-TVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPVTKELLVYSVNACLVYVQMCN   91 (206)
Q Consensus        13 ~~i~f~vNG~~~-~v~~~~~p~~tLLd~LR~~~~l~g~K~gC~eG~CGACtVlVdG~~~~~~~~~~~~v~sCl~~~~~~~   91 (206)
                      .+|+|+|||+++ ++  +++|+++|||+||++++++|+|+||++|.||||||+||++++.++.+..++|+||++|+.+++
T Consensus         3 ~~i~~~vNG~~~~~~--~~~p~~~Ll~~LR~~lgltGtK~GC~~G~CGACTVlvd~~~~~~~~~~g~~v~SCl~~a~~~~   80 (164)
T 3nvw_A            3 DELVFFVNGKKVVEK--NADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLH   80 (164)
T ss_dssp             CCEEEEETTEEEEET--TCCTTCBHHHHHHHTSCCTTSCCSCSSSSSCTTEEEEEEEETTTTEEEEEEEETTTCBGGGCT
T ss_pred             ceEEEEECCEEEEEe--cCCCCCCHHHHHHHHcCCCCcCCCcCCCCCCCCEEEEccccccccccCCcEEehhhhhHHHhC
Confidence            569999999986 56  899999999999999999999999999999999999997777777666779999999999999


Q ss_pred             CCeEEEEcCCCCCCCCccHHHHHHHHcCCCccccCCCCccccccccccCCCCchHHHHHHHHHHhCCCCCCHHHHHHHhc
Q psy7831          92 GWSIYTIDGLGDKKHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALG  171 (206)
Q Consensus        92 g~~I~TvEgL~~~~~~~~~vq~a~~~~~~~QCG~Ct~~~~~~~~~~~~~~~~PG~vm~~~~ll~~~~~~~~~~ei~~al~  171 (206)
                      |++|+|||||++.++.+||||+||++++++||||||                |||||++++||++++ +|+++||+++|+
T Consensus        81 G~~I~TiEGL~~~~~~lhpvQ~af~~~~~~QCGfCt----------------PG~imsa~aLl~~~p-~pt~~eI~~al~  143 (164)
T 3nvw_A           81 HVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCT----------------PGIVMSMYTLLRNQP-EPTVEEIEDAFQ  143 (164)
T ss_dssp             TCEEECGGGTCCTTSCCCHHHHHHHHTTCCSSCTTH----------------HHHHHHHHHHHHHCS-SCCHHHHHTSCT
T ss_pred             CcceEEecccCCCCCccCHHHHHHHHcCCCcCccch----------------hhHHHHHHHHHHhCC-CCCHHHHHHHHc
Confidence            999999999987556799999999999999999999                999999999999999 999999999999


Q ss_pred             CCcccCCCCHHHHHHHHHHH
Q psy7831         172 GNICRCTGYRPILDTFQSFA  191 (206)
Q Consensus       172 gnlCRCtgy~~i~~a~~~~a  191 (206)
                      |||||||||++|++||++|+
T Consensus       144 GNlCRCTgY~~I~~Av~~~~  163 (164)
T 3nvw_A          144 GNLCRCTGYRPILQGFRTFA  163 (164)
T ss_dssp             TCCCSSSCSHHHHHHHHTTC
T ss_pred             CCCCCCCCCHHHHHHHHHHh
Confidence            99999999999999999886
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1v97a290 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal dom 1e-23
d1v97a173 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Co 3e-16
d1jroa284 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, 1e-15
d1n62a279 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogen 1e-15
d1rm6c281 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase g 1e-15
d1t3qa281 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small 2e-15
d1ffva279 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogen 4e-15
d1dgja280 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-termi 4e-15
d1vlba280 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-termi 3e-14
d1t3qa181 a.56.1.1 (A:88-168) Quinoline 2-oxidoreductase sma 1e-13
d1n62a182 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydroge 2e-13
d1ffva176 a.56.1.1 (A:82-157) Carbon monoxide (CO) dehydroge 5e-13
d1rm6c176 a.56.1.1 (C:82-157) 4-hydroxybenzoyl-CoA reductase 1e-12
d1jroa182 a.56.1.1 (A:85-166) Xanthine dehydrogenase chain A 3e-12
d1vlba1113 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domai 4e-10
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 90 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin domains from multidomain proteins
domain: Xanthine oxidase, N-terminal domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 88.0 bits (218), Expect = 1e-23
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 1/91 (1%)

Query: 12  GKEVKFALNEKFYTVGEDVPVGTRLVDFIRDVAGLKGTKYMCREGGCGVCTVMVKSRHPV 71
             E+ F +N K     ++    T L+ ++R   GL+GTK  C EGGCG CTVM+     +
Sbjct: 1   ADELVFFVNGKKVVE-KNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRL 59

Query: 72  TKELLVYSVNACLVYVQMCNGWSIYTIDGLG 102
             +++ +S NACL  +   +  ++ T++G+G
Sbjct: 60  QDKIIHFSANACLAPICTLHHVAVTTVEGIG 90
>d1v97a1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 73 Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Length = 84 Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Length = 79 Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Length = 81 Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Length = 81 Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Length = 79 Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 80 Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 80 Back     information, alignment and structure
>d1t3qa1 a.56.1.1 (A:88-168) Quinoline 2-oxidoreductase small subunit QorS, C-domain {Pseudomonas putida [TaxId: 303]} Length = 81 Back     information, alignment and structure
>d1n62a1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Length = 82 Back     information, alignment and structure
>d1ffva1 a.56.1.1 (A:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Length = 76 Back     information, alignment and structure
>d1rm6c1 a.56.1.1 (C:82-157) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain {Thauera aromatica [TaxId: 59405]} Length = 76 Back     information, alignment and structure
>d1jroa1 a.56.1.1 (A:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus [TaxId: 1061]} Length = 82 Back     information, alignment and structure
>d1vlba1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1v97a173 Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxI 99.98
d1rm6c176 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 99.98
d1ffva176 Carbon monoxide (CO) dehydrogenase iron-sulfur pro 99.98
d1n62a182 Carbon monoxide (CO) dehydrogenase iron-sulfur pro 99.97
d1t3qa181 Quinoline 2-oxidoreductase small subunit QorS, C-d 99.97
d1vlba1113 Aldehyde oxidoreductase, domain 2 {Desulfovibrio g 99.96
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 99.96
d1jroa182 Xanthine dehydrogenase chain A, domain 2 {Rhodobac 99.96
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 99.96
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 99.96
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 99.96
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 99.95
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.95
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 99.95
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.95
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.74
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.7
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.65
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 98.33
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.31
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 98.26
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 98.25
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 98.23
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 98.12
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 98.11
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 98.03
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 98.03
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 97.99
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 97.98
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 97.82
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 97.8
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 97.75
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 97.69
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.53
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 97.29
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 97.15
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 97.13
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.05
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 97.02
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 96.93
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 88.22
d1tygb_65 Thiamin biosynthesis sulfur carrier protein ThiS { 87.79
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 86.63
d2cu3a163 Uncharacterised protein TTHA0675 {Thermus thermoph 81.47
>d1v97a1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: CO dehydrogenase ISP C-domain like
superfamily: CO dehydrogenase ISP C-domain like
family: CO dehydrogenase ISP C-domain like
domain: Xanthine oxidase, domain 2
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.98  E-value=8.1e-34  Score=201.94  Aligned_cols=71  Identities=48%  Similarity=0.983  Sum_probs=68.2

Q ss_pred             CCCccHHHHHHHHcCCCccccCCCCccccccccccCCCCchHHHHHHHHHHhCCCCCCHHHHHHHhcCCcccCCCCHHHH
Q psy7831         105 KHGYHKVQSRLALMNGTQCGYCSPGMVMAMHRTQCGYCSPGMVMAMHSFLMEHDYKVGKADVERALGGNICRCTGYRPIL  184 (206)
Q Consensus       105 ~~~~~~vq~a~~~~~~~QCG~Ct~~~~~~~~~~~~~~~~PG~vm~~~~ll~~~~~~~~~~ei~~al~gnlCRCtgy~~i~  184 (206)
                      +++|||||+||++++++||||||                |||||++++||++++ +|++++|+++|+|||||||||++|+
T Consensus         3 ~~~LhpvQ~Af~~~~a~QCGyCt----------------PG~vm~~~~ll~~~~-~pt~~~i~~alsGnlCRCtgY~~I~   65 (73)
T d1v97a1           3 KTRLHPVQERIAKSHGSQCGFCT----------------PGIVMSMYTLLRNQP-EPTVEEIEDAFQGNLCRCTGYRPIL   65 (73)
T ss_dssp             SSCCCHHHHHHHHTTCCSSCSSH----------------HHHHHHHHHHHHHCS-SCCHHHHHHTTTTCCCSSSCSHHHH
T ss_pred             CCCcCHHHHHHHHcCCCCCCCCc----------------hHHHHHHHHHHHhCC-cCCHHHHHHHHCcccccCCCCHHHH
Confidence            46799999999999999999999                999999999999999 9999999999999999999999999


Q ss_pred             HHHHHHHH
Q psy7831         185 DTFQSFAT  192 (206)
Q Consensus       185 ~a~~~~a~  192 (206)
                      +||+++|+
T Consensus        66 ~Av~~aak   73 (73)
T d1v97a1          66 QGFRTFAK   73 (73)
T ss_dssp             HHHGGGCC
T ss_pred             HHHHHHhC
Confidence            99998863
>d1rm6c1 a.56.1.1 (C:82-157) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva1 a.56.1.1 (A:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1t3qa1 a.56.1.1 (A:88-168) Quinoline 2-oxidoreductase small subunit QorS, C-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jroa1 a.56.1.1 (A:85-166) Xanthine dehydrogenase chain A, domain 2 {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure