Diaphorina citri psyllid: psy7835

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----

MSSSKNVANNGPPRGYEWEYARKDLGNTKWQNFKLCIYNPQTGEVFGRTPKSWGGIFLFYVIFYSILACLFAICMYVLMSTLTDEYPKLQLDESIIGVNPVTRKGNLTGNWRTIWVSCSGADPHDTETMGDVDYFPQPGYPGYFYPYTNTIGYLSPIIAVRFRNPGVGTLINVECRAWAKNIRYKKSGLNREGSVHFELLLEWND

cccccccccccccccccHHHcccccccccccccEEEEEccccccEEECcccccccccEEEEEEHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccccccccccCECcccccccccEEECcccccccccEEEEEEcccccccEEEEEEEEEccccccccccccccEEEEEEEEEEEcc

********************A****GNTKWQNFKLCIYNPQTGEVFGRTPKSWGGIFLFYVIFYSILACLFAICMYVLMSTLTDEYPKLQLDESIIGVNPVTRKGNLTGNWRTIWVSCSGADPHDTETMGDVDYFPQPGYPGYFYPYTNTIGYLSPIIAVRFRNPGVGTLINVECRAWAKNIRYKKSGLNREGSVHFELLLEWN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sodium/potassium-transporting ATPase subunit beta-2	This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.	confident	Q24048

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0008150 [BP]	biological_process	probable

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZXE, chain B
Confidence level:very confident
Coverage over the Query: 48-202
View the alignment between query and template
View the model in PyMOL