Diaphorina citri psyllid: psy7862


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
PYLSGLPDSVRAHQVDLTGGSDQVYLIEYFPYFPLITMYLMYYLGEDGKRVYTLKKVDPAGNPTVSAHPARFSPDDKYSRERITILRRFGLLRTQQPASAM
ccccccccHHHccccccccccccEEEEEECccccccEEEEEEEEcccccEEEEcccccccccccCCccccccccccccHHHHHHHHHHHcccccccccccc
****G**D********LTGGSDQVYLIEYFPYFPLITMYLMYYLGEDGKRVYTLKKVDPAGNPTVSAHPARFSPDDKYSRERITILRRFGLLRTQQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PYLSGLPDSVRAHQVDLTGGSDQVYLIEYFPYFPLITMYLMYYLGEDGKRVYTLKKVDPAGNPTVSAHPARFSPDDKYSRERITILRRFGLLRTQQPASAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
H/ACA ribonucleoprotein complex subunit 3 Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs.confidentQ6DRH5
H/ACA ribonucleoprotein complex subunit 3 Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs.confidentQ6BQP3
Putative H/ACA ribonucleoprotein complex subunit 3-like protein Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs.confidentQ9XVR8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031118 [BP]rRNA pseudouridine synthesisprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0001522, GO:1901360, GO:0006139, GO:0044260, GO:0071840, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0000154, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0034513 [MF]box H/ACA snoRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0030515, GO:1901363, GO:0003723
GO:0060215 [BP]primitive hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048568, GO:0048856, GO:0035162, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0031429 [CC]box H/ACA snoRNP complexprobableGO:0072588, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0005732, GO:0031981, GO:0005730, GO:0005634, GO:0030529, GO:0044452, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031120 [BP]snRNA pseudouridine synthesisprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0001522, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0040031, GO:0046483, GO:0016070, GO:0044238, GO:0016073, GO:0044237, GO:0043170
GO:0015030 [CC]Cajal bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y2Y, chain A
Confidence level:very confident
Coverage over the Query: 38-95
View the alignment between query and template
View the model in PyMOL