Diaphorina citri psyllid: psy7866

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MTNFDMYLGEHELLEEIQSIANKNEIWRSYIGLGYHNCLVPTVIQRNLFENPGWVTQYTPYQPEIAQGRLESLLNFQTMVSDLTGLSVANASLLDEATAAAEAMSICHR
cccccccccHHHHHHHHHHHHHHccccHHcccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcc
*****MYLGEHELLEEIQSIANKNEIWRSYIGLGYHNCLVPTVIQRNLFENPGWVTQYTPYQPEIAQGRLESLLNFQTMVSDLTGLSVANASLLDEATAAAEAMSICHR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNFDMYLGEHELLEEIQSIANKNEIWRSYIGLGYHNCLVPTVIQRNLFENPGWVTQYTPYQPEIAQGRLESLLNFQTMVSDLTGLSVANASLLDEATAAAEAMSICHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycine dehydrogenase [decarboxylating], mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.confidentQ91W43
Glycine dehydrogenase [decarboxylating], mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.confidentP15505
Glycine dehydrogenase [decarboxylating] The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein.confidentQ8DII3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0016594 [MF]glycine bindingprobableGO:0043168, GO:0043169, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0019464 [BP]glycine decarboxylation via glycine cleavage systemprobableGO:0006546, GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0009069, GO:0044712, GO:1901575, GO:0006544, GO:0006520, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0009071, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0005960 [CC]glycine cleavage complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004375 [MF]glycine dehydrogenase (decarboxylating) activityprobableGO:0016642, GO:0003824, GO:0003674, GO:0016638, GO:0016491
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0016829 [MF]lyase activityprobableGO:0003824, GO:0003674
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0009534 [CC]chloroplast thylakoidprobableGO:0009579, GO:0005737, GO:0031984, GO:0005575, GO:0043231, GO:0044464, GO:0031976, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0009536, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WYU, chain A
Confidence level:very confident
Coverage over the Query: 2-108
View the alignment between query and template
View the model in PyMOL