Diaphorina citri psyllid: psy7885


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
VPGRVNLIGEHIDYCRYSVPGRVNLIGEHIDYCRYSVCPMALEQNILVAFKCNENGDLNLYNIDDQKYDDYHSTVDTFR
cccEEccccccccCEEEEcccCEEEEEECccccccCEEEEEEcccEEEEEEEcccccEEEEEcccccccCEEECccccc
*PGRVNLIGEHIDYCRYSVPGRVNLIGEHIDYCRYSVCPMALEQNILVAFKCNENGDLNLYNIDDQKYDDYHSTVDTFR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VPGRVNLIGEHIDYCRYSVPGRVNLIGEHIDYCRYSVCPMALEQNILVAFKCNENGDLNLYNIDDQKYDDYHSTVDTFR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetylgalactosamine kinase Acts on GalNAc. Also acts as a galactokinase when galactose is present at high concentrations.confidentQ68FH4
Galactokinase Sugar-1-kinase with a very high substrate specificity for the alpha-anomeric configuration of D-galacose (D-Gal). Converts also efficiently 2-deoxy-D-Gal to 2-deoxy-D-al-1-phosphate.confidentQ9SEE5
N-acetylgalactosamine kinase Acts on GalNAc. Also acts as a galactokinase when galactose is present at high concentrations.confidentQ5XIG6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003674 [MF]molecular_functionprobable
GO:0008150 [BP]biological_processprobable
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2U, chain C
Confidence level:very confident
Coverage over the Query: 3-76
View the alignment between query and template
View the model in PyMOL