Diaphorina citri psyllid: psy7886


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MLGTQGGGMDQAIAFLASPGCAKHIQFHPLRSEDVVLPSQAVFVVAQSLATKNKAQSSEFNTRVVECRLSAKWIPHLQTPQQSYIKINMKKRNFLKGSLQDASYNIMLQKLSVPI
ccccccccHHHHHHHHcccccEEEEEEccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccc
MLGTQGGGMDQAIAFLASPGCAKHIQFHPLRSEDVVLPSQAVFVVAQSLATKNKAQSSEFNTRVVECRLSAKWIPHLQTPQQSYIKINMKKRNFLKGSLQDASYNIMLQKLSVP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGTQGGGMDQAIAFLASPGCAKHIQFHPLRSEDVVLPSQAVFVVAQSLATKNKAQSSEFNTRVVECRLSAKWIPHLQTPQQSYIKINMKKRNFLKGSLQDASYNIMLQKLSVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetylgalactosamine kinase Acts on GalNAc. Also acts as a galactokinase when galactose is present at high concentrations.confidentQ68FH4
Galactokinase Sugar-1-kinase with a very high substrate specificity for the alpha-anomeric configuration of D-galacose (D-Gal). Converts also efficiently 2-deoxy-D-Gal to 2-deoxy-D-al-1-phosphate.confidentQ9SEE5
N-acetylgalactosamine kinase Acts on GalNAc. Also acts as a galactokinase when galactose is present at high concentrations. May be involved in a salvage pathway for the reutilization of free GalNAc derived from the degradation of complex carbohydrates.confidentQ01415

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004335 [MF]galactokinase activityprobableGO:0019200, GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A2C, chain A
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL
Template: 3V5R, chain A
Confidence level:probable
Coverage over the Query: 2-101
View the alignment between query and template
View the model in PyMOL