Diaphorina citri psyllid: psy7887

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MSFNMSISSPFHSCSGSASLLVTTDSIPTAKKTLDIIAKKKDVDNWKDILYLGELQTKLAVSLKEMIDIADAILHPEAYTKEEVQEILEVSEEELDSDILTPNTRSVASFKVKQPLFVQEILEVSEEELDSDILTPNTRSVASFKVQEILEVSEEELDSDILTPNTRSVASFKVKQRALHVYEEAYRVERFLSVCRSDISEEQKLQQLGTLMNQSHTSLATKYECSHEALDSLVTCFREAGAYGARLTGAGWGGCVVALSDKSSCEALVTQVQAKFYTDQRTSSKPDLIFTTKPQTGAIIFQCDEEGGCQIVKYE

cccccccccccccccHHHHHHHHcccccccHHHHHHHHHcccccccccEEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccccHHHHHcHHHHHHHHcccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccHHHccccccHHHHHHHHHHHHHHccccccccccEEEEEcccccEEEEEcccccCEEEEcc

***********HSCSGSASLLVTTDSIPTAKKTLDIIAKKKDVDNWKDILYLGELQTKLAVSLKEMIDIADAILHPEAYTKEEVQEILEVSEEELDSDILTPNTRSVASFKVKQPLFVQEILEVSEEELDSDILTPNTRSVASFKVQEILEVSEEELDSDILTPNTRSVASFKVKQRALHVYEEAYRVERFLSVCRSDISEEQKLQQLGTLMNQSHTSLATKYECSHEALDSLVTCFREAGAYGARLTGAGWGGCVVALSDKSSCEALVTQVQAKFYTDQRTSSKPDLIFTTKPQTGAIIFQCDEEGGCQIV*Y*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A2C, chain A
Confidence level:very confident
Coverage over the Query: 21-100,163-302
View the alignment between query and template
View the model in PyMOL

Template: 2CZ9, chain A
Confidence level:very confident
Coverage over the Query: 140-300
View the alignment between query and template
View the model in PyMOL

Template: 2A2D, chain A
Confidence level:confident
Coverage over the Query: 118-301
View the alignment between query and template
View the model in PyMOL