Diaphorina citri psyllid: psy7892


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MRSDESSLYVSALEDLNLTNSNNKKAESQNSRKTVLKSKQTTVSEKKEKSLIEHFDKEIQLEDKLEVTGPPSDVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARIRY
ccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccEEEccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcc
************************************************************************DVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARIR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSDESSLYVSALEDLNLTNSNNKKAESQNSRKTVLKSKQTTVSEKKEKSLIEHFDKEIQLEDKLEVTGPPSDVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARIRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G2/mitotic-specific cyclin-B3 Cyclins are positive regulatory subunits of the cyclin-dependent kinases (CDKs), and thereby play an essential role in the control of the cell cycle, notably via their destruction during cell division. Could be involved at the G2/M (mitosis or meiosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed at mitosis.confidentP39963
Putative cyclin-A3-1 confidentQ9FMH5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0050793 [BP]regulation of developmental processprobableGO:0008150, GO:0065007, GO:0050789
GO:0010564 [BP]regulation of cell cycle processprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0016301 [MF]kinase activityprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016538 [MF]cyclin-dependent protein serine/threonine kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W98, chain B
Confidence level:very confident
Coverage over the Query: 83-239
View the alignment between query and template
View the model in PyMOL