Diaphorina citri psyllid: psy790

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MSEAAGGVPIYIPLQDTSPAEPGRHKSSADFKLDPAELESKFSSRTKLIILNTPHNPLGKVFTREELEVIAK
cCECcccEEEEEEccccccccccccccccccECcHHHHHHHccccccEEEEccccccccccccHHHHHHHHc
MSEAAGGVPIYIPLQDTS********SSADFKLDPAELESKFSSRTKLIILNTPHNPLGKVFTREELEVIAK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEAAGGVPIYIPLQDTSPAEPGRHKSSADFKLDPAELESKFSSRTKLIILNTPHNPLGKVFTREELEVIAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kynurenine--oxoglutarate transaminase 3 Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).confidentQ6YP21
Kynurenine--oxoglutarate transaminase 3 Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).confidentQ0P5G4
Kynurenine--oxoglutarate transaminase 3 Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).confidentQ58FK9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016212 [MF]kynurenine-oxoglutarate transaminase activityprobableGO:0036137, GO:0003824, GO:0008483, GO:0016740, GO:0003674, GO:0016769
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0006103 [BP]2-oxoglutarate metabolic processprobableGO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0047315 [MF]kynurenine-glyoxylate transaminase activityprobableGO:0036137, GO:0003824, GO:0008483, GO:0016740, GO:0003674, GO:0016769
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0047312 [MF]L-phenylalanine:pyruvate aminotransferase activityprobableGO:0003824, GO:0070546, GO:0008483, GO:0016740, GO:0003674, GO:0016769
GO:0009095 [BP]aromatic amino acid family biosynthetic process, prephenate pathwayprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0044238, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0009072, GO:0009073, GO:0008652, GO:1901564, GO:0006082, GO:1901566, GO:0046394, GO:0016053, GO:0044237, GO:0019438
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0047945 [MF]L-glutamine:pyruvate aminotransferase activityprobableGO:0070548, GO:0003824, GO:0008483, GO:0016740, GO:0003674, GO:0016769
GO:0033853 [MF]aspartate-prephenate aminotransferase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0004069 [MF]L-aspartate:2-oxoglutarate aminotransferase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0033854 [MF]glutamate-prephenate aminotransferase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0070189 [BP]kynurenine metabolic processprobableGO:0044238, GO:0044710, GO:0006520, GO:1901564, GO:0006575, GO:0019752, GO:0006082, GO:0042537, GO:0006725, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0009987, GO:1901605, GO:1901360, GO:0042180

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FVS, chain A
Confidence level:very confident
Coverage over the Query: 3-71
View the alignment between query and template
View the model in PyMOL