Diaphorina citri psyllid: psy7928


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MGHGVLWNPNLCTIIVGTIMMVTTWIATMIVDRLGRRILLLVSAVIMALSTLTMGYYFYLKNSGSDVSNIGWLPLGSLCVFIIVFSL
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcc
*****LWNPNLCTIIVGTIMMVTTWIATMIVDRLGRRILLLVSAVIMALSTLTMGYYFYLKNSGSDVSNIGWLPLGSLCVFIIVFSL
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHGVLWNPNLCTIIVGTIMMVTTWIATMIVDRLGRRILLLVSAVIMALSTLTMGYYFYLKNSGSDVSNIGWLPLGSLCVFIIVFSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Facilitated trehalose transporter Tret1 High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.confidentQ7PIR5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015767 [BP]lactose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015770 [BP]sucrose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015771 [BP]trehalose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015574 [MF]trehalose transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0051119, GO:1901476, GO:0005215, GO:0015157, GO:0022857, GO:0003674, GO:0015154, GO:0015151, GO:0015144, GO:0042947
GO:0015768 [BP]maltose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 8-85
View the alignment between query and template
View the model in PyMOL