Diaphorina citri psyllid: psy7936


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MSASKAVSASRLDGKTVIITGCNTGIGKVTAQTLYGIGAKVIMACRDVEKAETTASEIRKHFEVATSEDKKPGEVLIKKLDLASFKSIRDCAQDINQTEANVHILINNAVYCILSNNILFYSILFYAIPGKNVNVYAVHPGIVKTELGRYMDDTYFPGARTLGRVLMWWWMKTPEQGAQTTLHCALDEGAAKETGLYYSDYKVAKSRNFPFELKGKGKSTFD
cccccccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccccccccccCEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHcEEccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHccccc
*******SASRLDGKTVIITGCNTGIGKVTAQTLYGIGAKVIMACRDVEKAETTASEIRKHFEV***EDKKPGEVLIKKLDLASFKSIRDCAQDINQTEANVHILINNAVYCILSNNILFYSILFYAIPGKNVNVYAVHPGIVKTELGRYMDDTYFPGARTLGRVLMWWWMKTPEQGAQTTLHCALDEGAAKETGLYYSDYKVAKSRNFPFELK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASKAVSASRLDGKTVIITGCNTGIGKVTAQTLYGIGAKVIMACRDVEKAETTASEIRKHFEVATSEDKKPGEVLIKKLDLASFKSIRDCAQDINQTEANVHILINNAVYCILSNNILFYSILFYAIPGKNVNVYAVHPGIVKTELGRYMDDTYFPGARTLGRVLMWWWMKTPEQGAQTTLHCALDEGAAKETGLYYSDYKVAKSRNFPFELKGKGKSTFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Retinol dehydrogenase 12 Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Might be the key enzyme in the formation of 11-cis-retinal from 11-cis-retinol during regeneration of the cone visual pigments.confidentQ8BYK4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004745 [MF]retinol dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0042572 [BP]retinol metabolic processprobableGO:0042445, GO:0044710, GO:0065008, GO:0006629, GO:0044238, GO:0006721, GO:0006720, GO:0009987, GO:0044237, GO:0001523, GO:0071704, GO:0065007, GO:0008150, GO:0008152, GO:0016101, GO:0044255, GO:0010817, GO:0034754
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 5-58,72-147,171-202
View the alignment between query and template
View the model in PyMOL
Template: 3TOX, chain A
Confidence level:very confident
Coverage over the Query: 10-60,71-208
View the alignment between query and template
View the model in PyMOL