Diaphorina citri psyllid: psy7942

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MPSCLPGERRGGRTAEDIVNWLLKKTGPPAKEFTSVDEIKAFIADSKVVVAGLFKDASSELAKTFNEIASKVDDLVFDASSELAKTFNEIASKVDDLVFVTSTNADILAEYSVDDDTVAIFKKFDEGRVNYEGPASDEAALRKFLSTQSLPLVVEFNHETAQKIFGGEIKSHLLVFFSKAAGHYESHFEPVQTVAKDFREKEEQDEDDDQPKRDEL
ccccccccccccccHHHHHHHHHHHcccccEECccHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHcccccEEEEcHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHcccHcccccccccccccc
****LPG**RGGRTAEDIVNWLLKKTGPPAKEFTSVDEIKAFIADSKVVVAGLFKDASSELAKTFNEIASKVDDLVFDASSELAKTFNEIASKVDDLVFVTSTNADILAEYSVDDDTVAIFKKFDEGRVNYEGPASDEAALRKFLSTQSLPLVVEFNHETAQKIFGGEIKSHLLVFFSKAAGHYESHFEPVQTVAKDFREKEEQDED*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSCLPGERRGGRTAEDIVNWLLKKTGPPAKEFTSVDEIKAFIADSKVVVAGLFKDASSELAKTFNEIASKVDDLVFDASSELAKTFNEIASKVDDLVFVTSTNADILAEYSVDDDTVAIFKKFDEGRVNYEGPASDEAALRKFLSTQSLPLVVEFNHETAQKIFGGEIKSHLLVFFSKAAGHYESHFEPVQTVAKDFREKEEQDEDDDQPKRDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003824 [MF]catalytic activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F8U, chain A
Confidence level:very confident
Coverage over the Query: 3-78,101-212
View the alignment between query and template
View the model in PyMOL
Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 3-211
View the alignment between query and template
View the model in PyMOL