Diaphorina citri psyllid: psy7944

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-

MRHVYNADLDDINAPEPYIKEDFLQCLNPKFSFTNLLPSRQRLEMMREMYHNEAEMSPTSPDYNIESLTGGDPFYDRFPWFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQIVTDEESTDLTGTVKQSARIIFDDDQQTGRNNKKAVEDSGHQGDKVEENPPCTSSMYAFPEENGLWFPEKLTYLDKIGTVLKLRLQEYVSCCMPADLTFFSWLNFLLKI

cccccccccccccccccCEEEEEEEcccccCEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccCEEEEEEEEEEccccccccccEEEEEEcccccEEEEEEEEEEEEcccccccccccccccEEEEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccEEEEEccccccc

********LDDINAPEPYIKEDFLQCLNPKFSFTNLLPSRQRLEMMREMYHNEAEMSP******IESLTGGDPFYDRFPWFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQIVTDEESTDLTGTV****RII******************************************GLWFPEKLTYLDKIGTVLKLRLQEYVSCCMPADLTFFSWLNFLLKI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Kinesin-like protein unc-104	Involved in microtubule-associated transport.	confident	P23678
Kinesin-like protein KIF1A	Motor for anterograde axonal transport of synaptic vesicle precursors.	confident	Q12756
Kinesin-like protein unc-104	Required for presynaptic maturation, has a role in axonal transport of dense-core vesicles carrying synaptic vesicle precursors, components required for the morphological transformation of axonal growth cones to mature boutons.	confident	Q7PHR1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051656 [BP]	establishment of organelle localization	probable	GO:0009987, GO:0044763, GO:0044699, GO:0008150, GO:0051234, GO:0051179, GO:0051640, GO:0051641
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0003774 [MF]	motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0072384 [BP]	organelle transport along microtubule	probable	GO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMH, chain A
Confidence level:probable
Coverage over the Query: 81-124
View the alignment between query and template
View the model in PyMOL