Diaphorina citri psyllid: psy7951


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
ccccccEEEEEEccccccccEEEEECccccccccEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccc
*KVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0030695 [MF]GTPase regulator activityprobableGO:0003674, GO:0030234, GO:0060589
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A98, chain A
Confidence level:very confident
Coverage over the Query: 21-122
View the alignment between query and template
View the model in PyMOL