Psyllid ID: psy7951


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
ccccccEEEEEEccccccccEEEEEEccccccccEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccc
ccEEEcEEEEEEccccccEEEEEcccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccc
MKVFTEALVVqkstphqnirVLFTdlntrdtdreKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILsqtlpvdelkrvkhsvtstmdvgnkf
MKVFTEALvvqkstphqnirvlftdlntrdtdrekVFLVCYVIRIgstemslteEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRskilsqtlpvdelkrvkhsvtstmdvgnkf
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
******ALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTL**********************
*KVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFTEALVVQKSTPHQNIRVLFTDLNTRDTDREKVFLVCYVIRIGSTEMSLTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q8BUR4 1865 Dedicator of cytokinesis yes N/A 0.598 0.039 0.445 1e-12
Q14185 1865 Dedicator of cytokinesis yes N/A 0.598 0.039 0.445 1e-12
Q9H7D0 1870 Dedicator of cytokinesis no N/A 0.598 0.039 0.445 2e-12
B2RY04 1868 Dedicator of cytokinesis no N/A 0.598 0.039 0.445 3e-12
Q92608 1830 Dedicator of cytokinesis no N/A 0.631 0.042 0.448 5e-12
Q8C3J5 1828 Dedicator of cytokinesis no N/A 0.631 0.042 0.448 6e-12
Q8IZD9 2030 Dedicator of cytokinesis no N/A 0.598 0.035 0.405 4e-07
P59764 1978 Dedicator of cytokinesis no N/A 0.614 0.037 0.381 6e-07
Q8N1I0 1966 Dedicator of cytokinesis no N/A 0.614 0.038 0.381 6e-07
Q8CIQ7 2027 Dedicator of cytokinesis no N/A 0.598 0.036 0.405 6e-07
>sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus GN=Dock1 PE=1 SV=3 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 53/74 (71%), Gaps = 1/74 (1%)

Query: 49  EMSLTEEMTCVLREWLVLWKSLYLSD-RKSFKALEKRMHELIQLRSKILSQTLPVDELKR 107
           ++ L +E+T  LREW  +W+ LY+ D R+ F+++   +++LI+ RS+ILS TLP DELK 
Sbjct: 85  DLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKE 144

Query: 108 VKHSVTSTMDVGNK 121
           +K  VT+ +D GN+
Sbjct: 145 LKKKVTAKIDYGNR 158




Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1.
Mus musculus (taxid: 10090)
>sp|Q14185|DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens GN=DOCK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9H7D0|DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens GN=DOCK5 PE=1 SV=3 Back     alignment and function description
>sp|B2RY04|DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus GN=Dock5 PE=1 SV=2 Back     alignment and function description
>sp|Q92608|DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens GN=DOCK2 PE=1 SV=2 Back     alignment and function description
>sp|Q8C3J5|DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus GN=Dock2 PE=1 SV=3 Back     alignment and function description
>sp|Q8IZD9|DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens GN=DOCK3 PE=1 SV=1 Back     alignment and function description
>sp|P59764|DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus GN=Dock4 PE=1 SV=1 Back     alignment and function description
>sp|Q8N1I0|DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 Back     alignment and function description
>sp|Q8CIQ7|DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus GN=Dock3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
328724760 1857 PREDICTED: dedicator of cytokinesis prot 0.655 0.043 0.476 2e-15
328724758 1896 PREDICTED: dedicator of cytokinesis prot 0.655 0.042 0.476 2e-15
328724762 1665 PREDICTED: dedicator of cytokinesis prot 0.655 0.048 0.476 2e-15
270013806 1945 hypothetical protein TcasGA2_TC012454 [T 0.672 0.042 0.477 7e-15
91090316 1872 PREDICTED: similar to myoblast city CG10 0.672 0.043 0.477 7e-15
410895549 1867 PREDICTED: dedicator of cytokinesis prot 0.770 0.050 0.388 7e-14
347971696 2038 AGAP004320-PA [Anopheles gambiae str. PE 0.508 0.030 0.542 1e-13
156405675 1746 predicted protein [Nematostella vectensi 0.811 0.056 0.409 3e-13
241140966 1613 dock-1, putative [Ixodes scapularis] gi| 0.590 0.044 0.486 4e-13
158517915 1866 dedicator of cytokinesis protein 1 [Dani 0.770 0.050 0.388 4e-13
>gi|328724760|ref|XP_001948699.2| PREDICTED: dedicator of cytokinesis protein 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 58/86 (67%), Gaps = 6/86 (6%)

Query: 42  VIRIGSTEMS------LTEEMTCVLREWLVLWKSLYLSDRKSFKALEKRMHELIQLRSKI 95
           V + G  E++      +  E+T V+REW  +WK LY+S   +FK ++ +++ELI  RSKI
Sbjct: 74  VEKFGPAELTVLKQPQIVHELTSVIREWGAIWKQLYISHNSNFKNVKNKIYELINFRSKI 133

Query: 96  LSQTLPVDELKRVKHSVTSTMDVGNK 121
           LS TLPVDELK V+   TST+D+GNK
Sbjct: 134 LSGTLPVDELKEVQRLATSTIDIGNK 159




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328724758|ref|XP_003248245.1| PREDICTED: dedicator of cytokinesis protein 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328724762|ref|XP_003248246.1| PREDICTED: dedicator of cytokinesis protein 1-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270013806|gb|EFA10254.1| hypothetical protein TcasGA2_TC012454 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090316|ref|XP_972351.1| PREDICTED: similar to myoblast city CG10379-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|410895549|ref|XP_003961262.1| PREDICTED: dedicator of cytokinesis protein 1-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|347971696|ref|XP_313591.5| AGAP004320-PA [Anopheles gambiae str. PEST] gi|333468987|gb|EAA09231.5| AGAP004320-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156405675|ref|XP_001640857.1| predicted protein [Nematostella vectensis] gi|156227993|gb|EDO48794.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|241140966|ref|XP_002404881.1| dock-1, putative [Ixodes scapularis] gi|215493663|gb|EEC03304.1| dock-1, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|158517915|ref|NP_001103481.1| dedicator of cytokinesis protein 1 [Danio rerio] gi|157886690|emb|CAP09642.1| dedicator of cytokinesis 1 [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
ZFIN|ZDB-GENE-080108-5 1866 dock1 "dedicator of cytokinesi 0.614 0.040 0.486 2e-13
UNIPROTKB|F1NVR7 1849 DOCK1 "Uncharacterized protein 0.598 0.039 0.459 8.8e-13
UNIPROTKB|F1ND29 1921 DOCK1 "Uncharacterized protein 0.598 0.038 0.459 9.2e-13
UNIPROTKB|F1P803 1854 DOCK1 "Uncharacterized protein 0.598 0.039 0.445 3.8e-12
UNIPROTKB|L7N0E0 1855 DOCK1 "Uncharacterized protein 0.598 0.039 0.445 3.8e-12
RGD|1566072 1864 Dock1 "dedicator of cyto-kines 0.598 0.039 0.445 3.9e-12
MGI|MGI:2429765 1865 Dock1 "dedicator of cytokinesi 0.598 0.039 0.445 3.9e-12
UNIPROTKB|Q14185 1865 DOCK1 "Dedicator of cytokinesi 0.598 0.039 0.445 3.9e-12
UNIPROTKB|F1MIX6 1867 DOCK1 "Uncharacterized protein 0.598 0.039 0.445 3.9e-12
UNIPROTKB|F1PSR2 1869 DOCK5 "Uncharacterized protein 0.598 0.039 0.459 3.9e-12
ZFIN|ZDB-GENE-080108-5 dock1 "dedicator of cytokinesis 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 2.0e-13, P = 2.0e-13
 Identities = 37/76 (48%), Positives = 51/76 (67%)

Query:    48 TEMSLTEEMTCVLREWLVLWKSLYLSD-RKSFKALEKRMHELIQLRSKILSQTLPVDELK 106
             TE+ L  E+T  LREW  +W+ LY+ D R+ F  +   +++LI+ RS+ILS TLP DEL 
Sbjct:    83 TELPLVHEVTTTLREWAAIWRDLYVGDKREMFNTVRDMIYDLIEWRSQILSGTLPQDELT 142

Query:   107 RVKHSVTSTMDVGNKF 122
              +K  VTS MD GNK+
Sbjct:   143 ELKQRVTSKMDYGNKY 158




GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0007520 "myoblast fusion" evidence=IMP
UNIPROTKB|F1NVR7 DOCK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND29 DOCK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P803 DOCK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|L7N0E0 DOCK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1566072 Dock1 "dedicator of cyto-kinesis 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2429765 Dock1 "dedicator of cytokinesis 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14185 DOCK1 "Dedicator of cytokinesis protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIX6 DOCK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSR2 DOCK5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 93.97
KOG3775|consensus482 93.96
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 88.9
KOG4225|consensus 489 87.78
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 87.69
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 87.14
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 83.95
KOG4225|consensus489 83.09
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
Probab=93.97  E-value=0.057  Score=32.38  Aligned_cols=21  Identities=29%  Similarity=0.295  Sum_probs=17.4

Q ss_pred             ceEEEeccCCCCCcccceeeeEEE
Q psy7951          20 RVLFTDLNTRDTDREKVFLVCYVI   43 (122)
Q Consensus        20 ~~wy~g~~~~~~~~~gIFp~~~V~   43 (122)
                      .+|++|-.   ..+.|.||++||.
T Consensus        29 ~~W~~g~~---~g~~G~~P~~yV~   49 (49)
T PF14604_consen   29 DGWWYGRN---TGRTGLFPANYVE   49 (49)
T ss_dssp             TSEEEEEE---TTEEEEEEGGGEE
T ss_pred             CCEEEEEE---CCEEEEECHHhCC
Confidence            37999974   5689999999984



...

>KOG3775|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3a98_A184 Crystal Structure Of The Complex Of The Interacting 2e-12
>pdb|3A98|A Chain A, Crystal Structure Of The Complex Of The Interacting Regions Of Dock2 And Elmo1 Length = 184 Back     alignment and structure

Iteration: 1

Score = 67.4 bits (163), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/77 (42%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Query: 47 STEMSLTEEMTCVLREWLVLWKSLYLSDRKS-FKALEKRMHELIQLRSKILSQTLPVDEL 105 E+ L +E+T L EW +WK LY++ +K F ++ ++L + RS++LS TLP DEL Sbjct: 89 PAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSXXYDLXEWRSQLLSGTLPKDEL 148 Query: 106 KRVKHSVTSTMDVGNKF 122 K +K VTS +D GNK Sbjct: 149 KELKQKVTSKIDYGNKI 165

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 1e-18
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
 Score = 75.9 bits (186), Expect = 1e-18
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 47  STEMSLTEEMTCVLREWLVLWKSLYLS-DRKSFKALEKRMHELIQLRSKILSQTLPVDEL 105
             E+ L +E+T  L EW  +WK LY++  ++ F  ++  M++L++ RS++LS TLP DEL
Sbjct: 89  PAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDEL 148

Query: 106 KRVKHSVTSTMDVGNK 121
           K +K  VTS +D GNK
Sbjct: 149 KELKQKVTSKIDYGNK 164


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.95
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 96.77
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 95.84
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 95.26
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 95.25
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 94.95
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 94.91
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 94.85
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 94.81
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 94.78
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 94.76
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 94.44
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 94.27
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 94.26
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 94.1
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 94.06
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 94.05
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 93.99
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 93.82
1i07_A60 Epidermal growth factor receptor kinase substrate 93.81
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 93.8
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 93.8
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 93.79
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 93.78
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 93.69
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 93.69
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 93.69
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 93.68
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 93.65
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 93.56
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 93.53
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 93.49
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 93.46
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 93.44
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 93.43
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 93.42
1uti_A58 GRB2-related adaptor protein 2; signaling protein 93.39
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 93.33
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 93.32
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 93.3
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 93.28
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 93.27
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 93.26
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 93.25
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 93.18
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 93.12
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 93.11
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 93.11
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 93.08
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 93.05
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 92.97
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 92.95
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 92.92
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 92.9
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 92.8
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 92.79
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 92.79
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 92.69
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 92.68
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 92.68
2j6f_A62 CD2-associated protein; metal-binding, immune resp 92.64
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 92.61
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 92.57
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 92.5
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 92.38
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 92.38
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 92.38
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 92.33
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 92.3
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 92.26
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 92.24
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 92.19
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 92.17
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 92.13
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 92.13
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 92.08
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 91.95
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 91.94
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 91.93
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 91.93
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 91.92
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 91.91
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 91.9
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 91.82
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 91.81
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 91.79
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 91.76
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 91.73
2da9_A70 SH3-domain kinase binding protein 1; structural ge 91.71
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 91.71
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 91.7
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 91.69
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 91.68
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 91.68
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 91.68
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 91.65
2cuc_A70 SH3 domain containing ring finger 2; structural ge 91.58
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 91.57
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 91.52
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 91.5
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 91.48
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 91.44
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 91.39
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 91.38
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 91.37
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 91.37
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 91.36
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 91.32
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 91.17
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 91.07
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 91.07
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 91.07
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 91.06
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 91.05
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 90.99
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 90.97
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 90.96
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 90.86
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 90.82
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 90.77
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 90.77
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 90.72
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 90.68
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 90.57
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 90.54
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 90.45
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 90.42
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 90.36
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 90.33
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 90.29
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 90.25
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 90.23
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 90.08
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 90.06
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 90.04
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 89.97
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 89.92
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 89.9
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 89.87
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 89.86
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 89.81
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 89.78
3u23_A65 CD2-associated protein; structural genomics, struc 89.7
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 89.69
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 89.67
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 89.61
2dil_A69 Proline-serine-threonine phosphatase-interacting p 89.6
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 89.56
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 89.25
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 88.94
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 88.93
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 88.83
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 88.71
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 88.68
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 88.66
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 88.5
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 88.42
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 88.29
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 88.2
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 88.18
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 88.01
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 87.98
1wxb_A68 Epidermal growth factor receptor pathway substrate 87.49
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 87.37
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 87.25
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 87.03
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 86.9
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 86.77
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 86.67
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 85.67
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 85.41
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 83.77
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 82.91
1awj_A77 ITK; transferase, regulatory intramolecular comple 80.25
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=2.5e-29  Score=188.47  Aligned_cols=102  Identities=33%  Similarity=0.568  Sum_probs=94.5

Q ss_pred             eEEEeccCCCCCcccceeeeEEEEe-------------eccccccchhhhHHHHHHHHHHHHHHhhhh-hhHHHHHHHHH
Q psy7951          21 VLFTDLNTRDTDREKVFLVCYVIRI-------------GSTEMSLTEEMTCVLREWLVLWKSLYLSDR-KSFKALEKRMH   86 (122)
Q Consensus        21 ~wy~g~~~~~~~~~gIFp~~~V~~v-------------~~~e~plV~Eit~~LREW~~~~~~l~~~~~-~~f~~l~~~m~   86 (122)
                      +|++|...++..+.|+||++||..+             .+.+.|+++|++++||||+++|+++|+.++ ..|+.++++|+
T Consensus        50 ~W~~g~~~~~~g~~G~fP~nyV~~~~~~~~~~~~~e~~~~~~~plv~Ei~~~lrew~~~~~~ly~~~~~~~f~~l~~~~~  129 (184)
T 3a98_A           50 DWYRGYLIKHKMLQGIFPKSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMY  129 (184)
T ss_dssp             TEEEEEETTEEEEEEEEEGGGEEEECC-----------CCTHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             CEEEEEEecCCCceEEECcceEEEecccccccCcccccccccccHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHH
Confidence            5999998766678999999999995             244567899999999999999999999999 99999999999


Q ss_pred             HHHHHHHHHhcCCCCHHHHHHHHHHhhhhcccccCC
Q psy7951          87 ELIQLRSKILSQTLPVDELKRVKHSVTSTMDVGNKF  122 (122)
Q Consensus        87 ~L~~~R~qllsgtl~~de~~~lk~~v~~~id~GN~~  122 (122)
                      +|+++|+||+||+||+||+.+||+++|++||+||++
T Consensus       130 eL~~~R~qlls~~l~~dE~~~l~~~~~~~id~gn~~  165 (184)
T 3a98_A          130 DLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKI  165 (184)
T ss_dssp             HHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999973



>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 96.49
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 95.8
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 95.44
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 95.1
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 94.97
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 94.63
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 94.41
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 94.36
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 94.28
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 94.26
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 94.11
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 93.89
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 93.52
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 93.42
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.32
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 93.18
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 93.13
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 92.93
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 92.88
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 92.85
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 92.84
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 92.8
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 92.75
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 92.61
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 92.41
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 91.95
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 91.44
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 91.3
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 91.17
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 91.15
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 91.1
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 90.59
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 90.54
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 89.41
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 89.07
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 88.82
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 88.68
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 88.57
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 88.16
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 87.92
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 86.21
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 85.88
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 85.74
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 85.46
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 81.52
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 80.32
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.49  E-value=0.00045  Score=43.82  Aligned_cols=30  Identities=20%  Similarity=0.206  Sum_probs=24.1

Q ss_pred             ceEEEeccCCCCCcccceeeeEEEEeecccc
Q psy7951          20 RVLFTDLNTRDTDREKVFLVCYVIRIGSTEM   50 (122)
Q Consensus        20 ~~wy~g~~~~~~~~~gIFp~~~V~~v~~~e~   50 (122)
                      .+|++|...++ .+.|+||++||..+.+.+.
T Consensus        51 ~GW~~G~~~~~-g~~G~FP~nYVe~i~~~~~   80 (83)
T d1phta_          51 IGWLNGYNETT-GERGDFPGTYVEYIGRKKI   80 (83)
T ss_dssp             HCEEEEEETTT-TEEEEEEGGGEEEEEEEEC
T ss_pred             CCeEEEEECCC-CcEeeEehhhEEEcCCcCC
Confidence            35999987654 4889999999999877654



>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure