Diaphorina citri psyllid: psy796

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MAPPVVQWNISPSMGQSYKCREGDVVPIPRYCLRVLERLGSCHLGEMMICETEDIELDTEKVAVRTCRGDSLREIRFLSSLQDPNLVSILGVCTGEQPPWLVMEYPAQLGDLVQHLNSADNLTRDRDRYTCQSNVWSFAVTLWEILSLCRDKPFPHLTNEQVIQNAEHMYYGGELQVFLPKPSLCPRDIYDLMCDCWKRDQTMRPTFKQIYSFMKRSTNYKSNLDLRC

ccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccc

***PVVQWNISPSMGQSYKCREGDVVPIPRYCLRVLERLGSCHLGEMMICETEDIELDTEKVAVRTCRGDSLREIRFLSSLQDPNLVSILGVCTGEQPPWLVMEYPAQLGDLVQHLNSADNLTRDRDRYTCQSNVWSFAVTLWEILSLCRDKPFPHLTNEQVIQNAEHMYYGGELQVFLPKPSLCPRDIYDLMCDCWKRDQTMRPTFKQIYSFMKRSTN*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051128 [BP]	regulation of cellular component organization	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:2000026 [BP]	regulation of multicellular organismal development	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043408 [BP]	regulation of MAPK cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0050790 [BP]	regulation of catalytic activity	probable	GO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0019220 [BP]	regulation of phosphate metabolic process	probable	GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0004888 [MF]	transmembrane signaling receptor activity	probable	GO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0000904 [BP]	cell morphogenesis involved in differentiation	probable	GO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005575 [CC]	cellular_component	probable
GO:0004713 [MF]	protein tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0022603 [BP]	regulation of anatomical structure morphogenesis	probable	GO:0050793, GO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PSQ, chain A
Confidence level:very confident
Coverage over the Query: 20-221
View the alignment between query and template
View the model in PyMOL