Diaphorina citri psyllid: psy7970


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MGLGSQAADKKSSASIACFLAGNGADLSIKNKKGQTPLDLCPDPNLCKALTKCYKDKEVDQIEPRVGEGDGTEDMVTLDECRICSDLKRDILFQPCGHVACCSVCAPRVKKCLICREPVEKRIKIEECMVCSLKKASVLFKPCYHMVACESCASLMKKCVQCRTQIDHMHPMVVCCGGPGIISEVQHTTDPAEEENAVALSPNTSAATLVEASTSGALMNNGSRDTSTSDIQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQMCGDRMSECPICRKAVEKRILLY
ccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccEEECcccccccccccccccccccccccccEEEEEEEEEEEEccccccEEEcccccccHHHHHHHHHHHccccccccccccccEEEccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEcccccccHHHHccccccccccccccEEEEc
*************ASIACFLAGNGADLSIKNKKGQTPLDLCPDPNLCKALTKCYKDK*******************TLDECRICSDLKRDILFQPCGHVACCSVCAPRVKKCLICREPVEKRIKIEECMVCSLKKASVLFKPCYHMVACESCASLMKKCVQCRTQIDHMHPMVVCCGGPGIISEVQ******************************************************IKEQTMCPVCLDRLKNMIFLCGHGTCQMCGDRMSECPICRKAVEKRILLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLGSQAADKKSSASIACFLAGNGADLSIKNKKGQTPLDLCPDPNLCKALTKCYKDKEVDQIEPRVGEGDGTEDMVTLDECRICSDLKRDILFQPCGHVACCSVCAPRVKKCLICREPVEKRIKIEECMVCSLKKASVLFKPCYHMVACESCASLMKKCVQCRTQIDHMHPMVVCCGGPGIISEVQHTTDPAEEENAVALSPNTSAATLVEASTSGALMNNGSxxxxxxxxxxxxxxxxxxxxxTMCPVCLDRLKNMIFLCGHGTCQMCGDRMSECPICRKAVEKRILLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase MIB1 E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis (By similarity). Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation.confidentQ86YT6
E3 ubiquitin-protein ligase MIB1 E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation (By similarity). Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis.confidentQ80SY4
E3 ubiquitin-protein ligase mib1 E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. It thereby participates in many processes regulated by the Notch signaling pathway, such as midline cell fate specification prior to germ layer formation, patterning of sensory cell differentiation in the ear, neurogenesis of the hindbrain and commitment to a secretory fate in the intestine. Essential for early embryonic development.confidentQ804S5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0021915 [BP]neural tube developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0007368 [BP]determination of left/right symmetryprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0045664 [BP]regulation of neuron differentiationprobableGO:0030154, GO:0007275, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0001568 [BP]blood vessel developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0002090 [BP]regulation of receptor internalizationprobableGO:0032879, GO:0019222, GO:0060255, GO:0051049, GO:0031323, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0048259, GO:0060627, GO:0030100, GO:0050789
GO:0045807 [BP]positive regulation of endocytosisprobableGO:0051130, GO:0032879, GO:0051050, GO:0051049, GO:0060627, GO:0065007, GO:0048518, GO:0008150, GO:0051128, GO:0030100, GO:0050789, GO:0050794, GO:0048522
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6P, chain A
Confidence level:very confident
Coverage over the Query: 246-290
View the alignment between query and template
View the model in PyMOL
Template: 2EA5, chain A
Confidence level:very confident
Coverage over the Query: 73-126
View the alignment between query and template
View the model in PyMOL
Template: 2EA5, chain A
Confidence level:very confident
Coverage over the Query: 125-174
View the alignment between query and template
View the model in PyMOL
Template: 3T8K, chain A
Confidence level:confident
Coverage over the Query: 14-41
View the alignment between query and template
View the model in PyMOL