Diaphorina citri psyllid: psy7973

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MSQSANIIKQNGVCHQAKDKYPYFTKGIIVKGFGRGSKELGIPTANMCDEAVKSLPESFDPGVYYGWSKLSDGPTVYKMVMSIGWNPFYKNKKKSMEVHIIHEFGRDLYDLTLSICVLGYIRPELDFNSLGT
cccHHHHHHcccccHHccccccEEEEEEEECcccccccccccccccccccccccccccccccEEEEEEEEccccCEEEEEEEEEccccccccCEEEEEEEcccccccccccEEEEEEEEEcccccccccccc
*SQSANIIKQNGVCHQAKDKYPYFTKGIIVKGFGRGSKELGIPTANMCDEAVKSLPESFDPGVYYGWSKLSDGPTVYKMVMSIGWNPFYKNKKKSMEVHIIHEFGRDLYDLTLSICVLGYIRPELDFN*LG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQSANIIKQNGVCHQAKDKYPYFTKGIIVKGFGRGSKELGIPTANMCDEAVKSLPESFDPGVYYGWSKLSDGPTVYKMVMSIGWNPFYKNKKKSMEVHIIHEFGRDLYDLTLSICVLGYIRPELDFNSLGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Riboflavin kinase Catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin-mononucleotide (FMN).confidentQ969G6
Putative riboflavin kinase Catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin-mononucleotide (FMN).confidentO76206
Riboflavin kinase Catalyzes the phosphorylation of riboflavin (vitamin B2) to form flavin-mononucleotide (FMN).confidentQ8CFV9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008531 [MF]riboflavin kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009231 [BP]riboflavin biosynthetic processprobableGO:0006771, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0042727, GO:0042726, GO:0071704, GO:0018130, GO:0006767, GO:0006766, GO:0009987, GO:0009058, GO:0009110, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:1901566, GO:0042364, GO:0044237

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.26Riboflavin kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NB0, chain A
Confidence level:very confident
Coverage over the Query: 21-132
View the alignment between query and template
View the model in PyMOL