Diaphorina citri psyllid: psy7979


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MLDKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLEDEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
cccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccHHHHcccccccccccccccccEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHcccccccEEEEEEcccccc
****GDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGL************************RLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLEDEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polycomb group RING finger protein 3 Component of Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes.confidentQ07G17
Polycomb group RING finger protein 3 Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.confidentQ8BTQ0
Polycomb group RING finger protein 3 Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.confidentQ2KJ29

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0035518 [BP]histone H2A monoubiquitinationprobableGO:0010390, GO:0044699, GO:0044267, GO:0033522, GO:0044260, GO:0016574, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0032446, GO:0016570, GO:0009987, GO:0006464, GO:0071704, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0035102 [CC]PRC1 complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0031519, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CKL, chain A
Confidence level:confident
Coverage over the Query: 11-64
View the alignment between query and template
View the model in PyMOL
Template: 3GS2, chain A
Confidence level:confident
Coverage over the Query: 94-182
View the alignment between query and template
View the model in PyMOL