Psyllid ID: psy7979

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MLDKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLEDEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
cccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccHHHHcccccccccccccccccEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHcccccccEEEEEEcccccc
ccccccHHHHccccccccEEEEcccccHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccEEEEccHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccEEEEEEEEcccccccEEEEEEEEEEcc
mldkgdkkkikntcpscniiihqshplqyisfDRTMQDLVYKLVPNLQANEMKREREFYRirglpcpkdllledeeeentdqvnsdyhrldEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLldekskykeidilcndellgkdhtlKFVYITrwrfrtpplklqyrpridil
mldkgdkkkikntcpscniiihQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLEDEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDIlcndellgkdhTLKFvyitrwrfrtpplklqyrpridil
MLDKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKdllledeeeeNTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
***********NTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPC**********************RLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYR******
****GDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFY********************************EQVNV****************KRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
*********IKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLED**********SDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
**DKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGL*********************DYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDKGDKKKIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLLLEDEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q8BTQ0241 Polycomb group RING finge yes N/A 0.913 0.705 0.517 3e-52
Q2KJ29242 Polycomb group RING finge yes N/A 0.913 0.702 0.525 8e-52
Q3KNV8242 Polycomb group RING finge yes N/A 0.913 0.702 0.520 1e-51
Q07G17242 Polycomb group RING finge yes N/A 0.913 0.702 0.520 1e-51
B3DK16234 Polycomb group RING finge yes N/A 0.903 0.717 0.380 9e-30
Q3UK78256 Polycomb group RING finge no N/A 0.908 0.660 0.352 1e-27
Q1JPS1232 Polycomb group RING finge no N/A 0.903 0.724 0.401 6e-27
A0JN86255 Polycomb group RING finge no N/A 0.903 0.658 0.347 4e-26
Q86SE9256 Polycomb group RING finge no N/A 0.908 0.660 0.342 2e-25
Q9BSM1259 Polycomb group RING finge no N/A 0.854 0.613 0.359 4e-23
>sp|Q8BTQ0|PCGF3_MOUSE Polycomb group RING finger protein 3 OS=Mus musculus GN=PcgF3 PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (518), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/197 (51%), Positives = 133/197 (67%), Gaps = 27/197 (13%)

Query: 12  NTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDLL 71
           NTCP+C I+IHQSHPLQYI  DRTMQD+VYKLVP LQ  EM+++REFY   G+  P D+ 
Sbjct: 50  NTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIK 109

Query: 72  LE----------------------DEEEENTDQVNSDYHRLDEQVNVYLECSVATTSSLK 109
            E                       E  E   + ++DYHR DEQV++ LEC+   +S L+
Sbjct: 110 GEACSAKQHLDPRNGETKADDNSNKETAEEKQEEDNDYHRSDEQVSICLECN---SSKLR 166

Query: 110 TLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWR 169
            LK+++IR S+QAT+ HLKKF+A KL    S + E+DILCN+E+LGKDHTLKFV +TRWR
Sbjct: 167 GLKRKWIRCSAQATVLHLKKFIAKKL--NLSSFNELDILCNEEILGKDHTLKFVVVTRWR 224

Query: 170 FRTPPLKLQYRPRIDIL 186
           F+  PL L YRP++D+L
Sbjct: 225 FKKAPLLLHYRPKMDLL 241
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Mus musculus (taxid: 10090)
>sp|Q2KJ29|PCGF3_BOVIN Polycomb group RING finger protein 3 OS=Bos taurus GN=PCGF3 PE=2 SV=1 Back     alignment and function description
>sp|Q3KNV8|PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens GN=PCGF3 PE=1 SV=1 Back     alignment and function description
>sp|Q07G17|PCGF3_XENTR Polycomb group RING finger protein 3 OS=Xenopus tropicalis GN=pcgf3 PE=2 SV=1 Back     alignment and function description
>sp|B3DK16|PCF5A_DANRE Polycomb group RING finger protein 5-A OS=Danio rerio GN=pcgf5a PE=2 SV=1 Back     alignment and function description
>sp|Q3UK78|PCGF5_MOUSE Polycomb group RING finger protein 5 OS=Mus musculus GN=Pcgf5 PE=2 SV=1 Back     alignment and function description
>sp|Q1JPS1|PCF5B_DANRE Polycomb group RING finger protein 5-B OS=Danio rerio GN=pcgf5b PE=2 SV=1 Back     alignment and function description
>sp|A0JN86|PCGF5_BOVIN Polycomb group RING finger protein 5 OS=Bos taurus GN=PCGF5 PE=2 SV=1 Back     alignment and function description
>sp|Q86SE9|PCGF5_HUMAN Polycomb group RING finger protein 5 OS=Homo sapiens GN=PCGF5 PE=1 SV=1 Back     alignment and function description
>sp|Q9BSM1|PCGF1_HUMAN Polycomb group RING finger protein 1 OS=Homo sapiens GN=PCGF1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
383866191230 PREDICTED: polycomb group RING finger pr 0.924 0.747 0.744 3e-72
328776963230 PREDICTED: polycomb group RING finger pr 0.924 0.747 0.727 1e-71
332022202226 Polycomb group RING finger protein 3 [Ac 0.924 0.761 0.722 7e-70
156552700224 PREDICTED: polycomb group RING finger pr 0.924 0.767 0.722 8e-70
357624741 310 hypothetical protein KGM_03599 [Danaus p 0.924 0.554 0.709 4e-69
91076158224 PREDICTED: similar to ring finger protei 0.919 0.763 0.720 3e-68
307193493226 Polycomb group RING finger protein 3 [Ha 0.924 0.761 0.705 3e-68
307182744226 Polycomb group RING finger protein 3 [Ca 0.924 0.761 0.7 9e-68
193643640224 PREDICTED: polycomb group RING finger pr 0.919 0.763 0.681 1e-67
332375530225 unknown [Dendroctonus ponderosae] 0.919 0.76 0.707 3e-66
>gi|383866191|ref|XP_003708554.1| PREDICTED: polycomb group RING finger protein 3-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 153/180 (85%), Gaps = 8/180 (4%)

Query: 11  KNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKDL 70
           K+TCP+C I+IHQSHPLQYISFDRTMQD+VYKLVP+LQ NE+KREREFYR RGLPCPKD+
Sbjct: 54  KHTCPTCQIVIHQSHPLQYISFDRTMQDIVYKLVPDLQENEIKREREFYRARGLPCPKDV 113

Query: 71  LLE----DEEEENTD-QVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATIT 125
           L      +EE+ NTD    SDYHR DEQVNV LEC     +SLKTLK+RFIR S+QATIT
Sbjct: 114 LPNAGEVEEEKANTDAHAESDYHRADEQVNVCLEC---MNTSLKTLKRRFIRCSAQATIT 170

Query: 126 HLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDI 185
           HLKKF+A K+L+   KY++IDILCNDELLGKDHTLKFVY+TRWRFR PPL+LQYRPRIDI
Sbjct: 171 HLKKFIAKKVLNGMEKYRDIDILCNDELLGKDHTLKFVYVTRWRFRDPPLRLQYRPRIDI 230

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328776963|ref|XP_001120353.2| PREDICTED: polycomb group RING finger protein 3-like [Apis mellifera] gi|340728415|ref|XP_003402520.1| PREDICTED: polycomb group RING finger protein 3-like [Bombus terrestris] gi|350405292|ref|XP_003487388.1| PREDICTED: polycomb group RING finger protein 3-like [Bombus impatiens] gi|380024257|ref|XP_003695920.1| PREDICTED: polycomb group RING finger protein 3-like [Apis florea] Back     alignment and taxonomy information
>gi|332022202|gb|EGI62517.1| Polycomb group RING finger protein 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156552700|ref|XP_001599688.1| PREDICTED: polycomb group RING finger protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357624741|gb|EHJ75399.1| hypothetical protein KGM_03599 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91076158|ref|XP_971006.1| PREDICTED: similar to ring finger protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307193493|gb|EFN76270.1| Polycomb group RING finger protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307182744|gb|EFN69868.1| Polycomb group RING finger protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|193643640|ref|XP_001947143.1| PREDICTED: polycomb group RING finger protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332375530|gb|AEE62906.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
FB|FBgn0002283222 l(3)73Ah "lethal (3) 73Ah" [Dr 0.924 0.774 0.646 5.7e-59
UNIPROTKB|F1NLA3245 PCGF3 "Uncharacterized protein 0.526 0.4 0.582 2.3e-50
UNIPROTKB|Q2KJ29242 PCGF3 "Polycomb group RING fin 0.526 0.404 0.582 3.7e-50
UNIPROTKB|Q3KNV8242 PCGF3 "Polycomb group RING fin 0.526 0.404 0.582 4.7e-50
MGI|MGI:1916837241 Pcgf3 "polycomb group ring fin 0.526 0.406 0.582 4.7e-50
UNIPROTKB|Q07G17242 pcgf3 "Polycomb group RING fin 0.516 0.396 0.594 7.7e-50
UNIPROTKB|F1PGG1286 PCGF3 "Uncharacterized protein 0.526 0.342 0.582 9.8e-50
UNIPROTKB|J9P325269 PCGF3 "Uncharacterized protein 0.478 0.330 0.574 3.4e-49
UNIPROTKB|E1BAF7242 E1BAF7 "Uncharacterized protei 0.537 0.413 0.542 9.6e-44
UNIPROTKB|F1PTT1256 PCGF5 "Uncharacterized protein 0.844 0.613 0.385 3e-33
FB|FBgn0002283 l(3)73Ah "lethal (3) 73Ah" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 605 (218.0 bits), Expect = 5.7e-59, P = 5.7e-59
 Identities = 115/178 (64%), Positives = 139/178 (78%)

Query:    11 KNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRGLPCPKXX 70
             K TCP+C+ IIHQSHPLQYISFDRTMQD+VYKLVP LQ +E +RER+FY+ R +PCPK  
Sbjct:    48 KKTCPTCDNIIHQSHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDI 107

Query:    71 XXXXXXXXNT--D-QVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHL 127
                         D    SD+HRLDEQVNV LEC    +++ K L++RFIR SSQATITHL
Sbjct:   108 TQNHEDDNEKVMDAHAESDFHRLDEQVNVCLEC---ISNNFKNLQRRFIRCSSQATITHL 164

Query:   128 KKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFRTPPLKLQYRPRIDI 185
             KK VA K+L+   KY+EIDILCN+ELLGKDHTLKFVY+TRWRFR PPL+LQ+RPR+++
Sbjct:   165 KKLVAKKILNGIEKYREIDILCNEELLGKDHTLKFVYVTRWRFRDPPLRLQFRPRVEL 222
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1NLA3 PCGF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ29 PCGF3 "Polycomb group RING finger protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3KNV8 PCGF3 "Polycomb group RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916837 Pcgf3 "polycomb group ring finger 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q07G17 pcgf3 "Polycomb group RING finger protein 3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGG1 PCGF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P325 PCGF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAF7 E1BAF7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTT1 PCGF5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BTQ0PCGF3_MOUSENo assigned EC number0.51770.91390.7053yesN/A
B3DK16PCF5A_DANRENo assigned EC number0.38090.90320.7179yesN/A
Q07G17PCGF3_XENTRNo assigned EC number0.52020.91390.7024yesN/A
Q3KNV8PCGF3_HUMANNo assigned EC number0.52020.91390.7024yesN/A
Q2KJ29PCGF3_BOVINNo assigned EC number0.52520.91390.7024yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG2660|consensus331 100.0
PF11816331 DUF3337: Domain of unknown function (DUF3337); Int 98.27
cd0161287 APG12_C Ubiquitin-like domain of APG12. APG12_C Th 97.57
cd01611112 GABARAP Ubiquitin domain of GABA-receptor-associat 97.33
PF02991104 Atg8: Autophagy protein Atg8 ubiquitin like; Inter 97.21
PTZ00380121 microtubule-associated protein (MAP); Provisional 97.2
KOG1654|consensus116 96.13
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 95.94
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 95.89
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.58
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 95.52
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 95.33
PF0411087 APG12: Ubiquitin-like autophagy protein Apg12 ; In 95.32
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 95.07
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 95.02
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 94.83
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 94.75
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 94.41
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 94.24
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 94.13
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 93.95
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 93.92
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 93.86
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 93.85
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 93.54
KOG0311|consensus 381 93.48
PTZ0004476 ubiquitin; Provisional 93.45
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 93.32
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 93.31
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 93.0
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 92.48
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 90.35
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 89.8
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 89.58
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 88.9
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 88.54
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 88.47
KOG0308|consensus735 88.02
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 86.28
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 85.25
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 84.73
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 83.78
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 82.43
KOG3439|consensus116 80.49
>KOG2660|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.6e-45  Score=313.47  Aligned_cols=170  Identities=49%  Similarity=0.793  Sum_probs=140.0

Q ss_pred             cCCCCCCcccccccccCCccccccchhHHhhhHhhcccchhhHHHHHHHHHHHhC-CCCCCCCCCC------chhhhccc
Q psy7979           9 KIKNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIRG-LPCPKDLLLE------DEEEENTD   81 (186)
Q Consensus         9 ~~~~~CP~C~~~ih~s~Pl~~i~~D~tLQdIVyKLVPgL~~~E~~rr~eFy~~~~-~~~p~~~~~~------~~~~~~~~   81 (186)
                      +.+++||+|++.||+++|++||++|+|||||||||||||+++|++++++||+++| +..|++....      .++...+.
T Consensus        48 ~~~~~CP~C~i~ih~t~pl~ni~~DrtlqdiVyKLVPgl~erE~k~~rdFy~~~~~~d~~~~~~~~~~~~~~~ek~~~t~  127 (331)
T KOG2660|consen   48 EESKYCPTCDIVIHKTHPLLNIRSDRTLQDIVYKLVPGLQEREMKRRRDFYKSRPLVDVPAGDTPERGHVLGEEKVPDTS  127 (331)
T ss_pred             HHhccCCccceeccCccccccCCcchHHHHHHHHHcchHHHHHHHHHHHHHHhCCCcccCCCCCcccccccCcccCCCch
Confidence            4589999999999999999999999999999999999999999999999999999 6666554321      11100000


Q ss_pred             ---------cccCCCCCCCCceeEEEEeccCCCCccccccccEEEecccccHHHHHHHHHHHhhcCCCCCceEEEEeCCE
Q psy7979          82 ---------QVNSDYHRLDEQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDE  152 (186)
Q Consensus        82 ---------~~~~~~~~~de~vsl~LE~~~~~~~~l~~l~~~ylrcs~~~tV~hLkKfL~~Kl~~~l~~~~~veIlc~~~  152 (186)
                               ..+...|+.|+++++.++..   .++++.+.++|+||||++||+||+|||+.|+++ ++...+|||+|+++
T Consensus       128 ~~~~s~~l~~~~~~~~r~d~~~~~~~~e~---~~~~k~l~~~fvrcsa~~Tv~hlkkfl~~k~~~-~~~~~~idi~~~d~  203 (331)
T KOG2660|consen  128 DEIASLSLEVEDFKQNRLDEQVSVGLDEG---KDTLKDLVRRFLRCSAAATVNHLKKFLRKKMDN-LSNKSEIDILCEEE  203 (331)
T ss_pred             hhhhccccchhhcccchhhhhhhcCCCcc---cccccccccceEeccHHHHHHHHHHHHHHHhcc-ccchhhheeecCCc
Confidence                     01123456677777766544   567888889999999999999999999999953 88899999999999


Q ss_pred             ecCCCCcHHHH-HHHhccCCCCCeeEEEeec
Q psy7979         153 LLGKDHTLKFV-YITRWRFRTPPLKLQYRPR  182 (186)
Q Consensus       153 ~L~~~~TL~~I-~~~~W~~~~~Pm~L~Yr~~  182 (186)
                      +|++++||++| +.++|+.+++||+|+||..
T Consensus       204 ~l~~~~TLk~i~~~~~~~~r~~pL~l~y~v~  234 (331)
T KOG2660|consen  204 LLGDYYTLKDIAYAYRWRSRDPPLPLRYRVK  234 (331)
T ss_pred             cccchhhhhhhhhhhcccccCCcceeEeccc
Confidence            99999999987 7778875799999999954

>PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised Back     alignment and domain information
>cd01612 APG12_C Ubiquitin-like domain of APG12 Back     alignment and domain information
>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information
>PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules Back     alignment and domain information
>PTZ00380 microtubule-associated protein (MAP); Provisional Back     alignment and domain information
>KOG1654|consensus Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>KOG3439|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3rpg_B117 Bmi1RING1B-Ubch5c Complex Structure Length = 117 3e-10
2ckl_A108 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 4e-10
2h0d_A97 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 4e-10
>pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 35/46 (76%)
Query: 14 CPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFY 59
          CP C++ +H++ PL  I  D+T+QD+VYKLVP L  NEMKR R+FY
Sbjct: 53 CPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFY 98
>pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 Back     alignment and structure
>pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-13
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-09
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
 Score = 62.5 bits (152), Expect = 2e-13
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 11  KNTCPSCNIIIHQSHPLQYISFDRTMQDLVYKLVPNLQANEMKREREFYRIR 62
              CP C++ +H++ PL  I  D+T+QD+VYKLVP L  NEMKR R+FY   
Sbjct: 50  SKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH 101
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3gs2_A111 E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C 99.31
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.86
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 97.49
4gdk_A91 Ubiquitin-like protein ATG12; protein-protein conj 97.45
3rui_B118 Autophagy-related protein 8; autophagosome formati 97.41
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 97.33
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 97.3
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 97.29
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 97.21
1wz3_A96 Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla 96.75
3w1s_C91 Ubiquitin-like protein ATG12; ubiquitin fold, E3-l 96.69
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.29
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 95.47
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 95.38
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 95.31
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 95.25
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 95.16
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 95.15
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 95.14
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 95.11
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 95.09
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 94.92
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 94.88
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 94.83
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 94.8
3v6c_B91 Ubiquitin; structural genomics, structural genomic 94.69
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 94.66
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 94.62
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 94.6
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 94.4
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 94.38
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 94.31
2fnj_B118 Transcription elongation factor B polypeptide 2; b 94.27
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 94.24
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 94.21
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 94.18
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 94.12
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 94.1
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 94.09
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 94.09
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 94.06
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 93.97
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 93.94
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 93.68
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 93.67
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 93.56
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 93.55
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 93.46
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 93.34
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 93.31
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 93.25
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 93.16
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 92.84
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 92.79
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 92.7
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 92.69
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 92.64
3m62_B106 UV excision repair protein RAD23; armadillo-like r 92.56
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 92.25
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 92.24
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 91.99
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 91.92
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 91.78
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 91.51
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 91.47
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 91.37
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 91.22
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 90.52
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 91.05
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 90.36
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 90.35
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 90.3
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 90.07
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 89.91
1we6_A111 Splicing factor, putative; structural genomics, ub 89.88
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 89.84
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 89.77
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 89.66
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 88.67
4ajy_B118 Transcription elongation factor B polypeptide 2; E 88.61
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 87.62
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 87.62
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 87.01
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 86.7
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 85.98
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 85.74
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 84.62
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 84.47
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 84.38
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 81.86
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 81.81
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 81.43
>3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* Back     alignment and structure
Probab=99.31  E-value=1.2e-11  Score=91.18  Aligned_cols=88  Identities=24%  Similarity=0.444  Sum_probs=65.5

Q ss_pred             eeEEEEeccCCCCccccccccEEEecccccHHHHHHHHHHHhhcCC-C-------------CCceEEEEeC---C--Eec
Q psy7979          94 VNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEK-S-------------KYKEIDILCN---D--ELL  154 (186)
Q Consensus        94 vsl~LE~~~~~~~~l~~l~~~ylrcs~~~tV~hLkKfL~~Kl~~~l-~-------------~~~~veIlc~---~--~~L  154 (186)
                      |.|.+.+++..-..=.....|||+++++|||.||.||||+|++++. .             +..+..|++.   |  ..|
T Consensus         4 iELVFrPHPt~~~~d~~~~~RYIKTt~nATVDHLsKYLA~Rl~Le~~~~~~e~~~~~~~~~~~~~~~IYia~~~gq~~~L   83 (111)
T 3gs2_A            4 IELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVL   83 (111)
T ss_dssp             EEEEEEECTTTSCCCTTCCCEEEEEETTCBHHHHHHHHHHHHHHHHHHHHHHSSCCSCCC--CCCEEEEEECTTSCEEEC
T ss_pred             eEEEecCCcccccccchhceEEEEcCCCccHHHHHHHHHHHHhHHHhhccccccccCccccceeeeEEEEccCCCeEEEc
Confidence            5566666543211101236699999999999999999999996652 1             2336667764   3  489


Q ss_pred             CCCCcHHHHHHHhccCCCCCeeEEEeec
Q psy7979         155 GKDHTLKFVYITRWRFRTPPLKLQYRPR  182 (186)
Q Consensus       155 ~~~~TL~~I~~~~W~~~~~Pm~L~Yr~~  182 (186)
                      ..++||+.|...+|+. +.||.|+|.++
T Consensus        84 ~gs~tLe~VneKywkv-nkplelYYa~~  110 (111)
T 3gs2_A           84 DGSFSLELVSEKYWKV-NKPMELYYAPT  110 (111)
T ss_dssp             CTTSBHHHHHHHHTCS-SSCEEEEEEEC
T ss_pred             cCcccHHHHhhhhccC-CCCeeEEeccc
Confidence            9999999999999997 89999999864
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 Back     alignment and structure
>4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A Back     alignment and structure
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Back     alignment and structure
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Back     alignment and structure
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Back     alignment and structure
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 Back     alignment and structure
>3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d3d32a1118 GABA(A) receptor associated protein GABARAP {Human 97.39
d1eo6a_116 Golgi-associated ATPase enhancer of 16 kD, Gate-16 97.09
d2zjda1119 Microtubule-associated proteins 1A/1B light chain 96.8
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 96.51
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 96.29
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 96.03
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 96.02
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 95.51
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 95.34
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 95.32
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 95.31
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 95.25
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 95.25
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.13
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 95.06
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 95.06
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 94.94
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 94.92
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 94.86
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 94.82
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 94.73
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 94.63
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 94.56
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 94.02
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 93.86
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 93.54
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 93.51
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 93.31
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 91.75
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 91.27
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 91.26
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 90.14
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 90.05
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 90.03
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 89.6
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 87.84
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 87.52
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 87.07
d1wz3a184 Autophagy-related protein 12b (APG12b) {Thale cres 84.42
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 84.21
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 82.53
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: GABARAP-like
domain: GABA(A) receptor associated protein GABARAP
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.39  E-value=0.001  Score=48.02  Aligned_cols=86  Identities=14%  Similarity=0.164  Sum_probs=73.6

Q ss_pred             CceeEEEEeccCCCCccccccccEEEecccccHHHHHHHHHHHhhcCCCCCceEEEEeCCEecCCCCcHHHHHHHhccCC
Q psy7979          92 EQVNVYLECSVATTSSLKTLKKRFIRLSSQATITHLKKFVALKLLDEKSKYKEIDILCNDELLGKDHTLKFVYITRWRFR  171 (186)
Q Consensus        92 e~vsl~LE~~~~~~~~l~~l~~~ylrcs~~~tV~hLkKfL~~Kl~~~l~~~~~veIlc~~~~L~~~~TL~~I~~~~W~~~  171 (186)
                      +.|-+.+|..+  .+.++.+.++-.-+|..+||+.+...|++++  .+++...+=+++||..++.+.||.+||...=.. 
T Consensus        29 driPVIve~~~--~s~lp~ldk~KflVp~d~tv~qf~~~iRkrl--~l~~~~alflfvn~~~~~~~~ti~~lY~~~kde-  103 (118)
T d3d32a1          29 DRVPVIVEKAP--KARIGDLDKKKYLVPSDLTVGQFYFLIRKRI--HLRAEDALFFFVNNVIPPTSATMGQLYQEHHEE-  103 (118)
T ss_dssp             TEEEEEEEECT--TCCSCCCSCSEEEEETTCBHHHHHHHHHHHH--TCCTTSCCEEEBTTBCCCTTCBHHHHHHHHCCT-
T ss_pred             CCceEEEEEcC--CCCCcccccceEEecCCccHHHHHHHHHHHh--CCCccceEEEEECCcccCccccHHHHHHHhCCC-
Confidence            46888888753  3468888888888999999999999999999  899888888999999999999999999877654 


Q ss_pred             CCCeeEEEeec
Q psy7979         172 TPPLKLQYRPR  182 (186)
Q Consensus       172 ~~Pm~L~Yr~~  182 (186)
                      ++-|-+.|+--
T Consensus       104 DGfLYi~Ys~e  114 (118)
T d3d32a1         104 DFFLYIAYSDE  114 (118)
T ss_dssp             TSCEEEEEESC
T ss_pred             CcEEEEEEecc
Confidence            88999999743
>d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure